KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_041331Help
Entry
NH44784_041331    CDS       T02785                                 

Definition
(GenBank) Sarcosine oxidase beta subunit
Organism
axo  Achromobacter xylosoxidans NH44784-1996
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Thi4 Pyr_redox Shikimate_DH Pyr_redox_2 Pyr_redox_3 GMC_oxred_N Trp_halogenase NAD_binding_8 FAD_oxidored GIDA ThiF NAD_binding_9 NAD_binding_7 FAD_binding_3 ApbA AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CCH08077
LinkDB All DBs
Position
4413101..4414288
Genome map
AA seq 395 aa AA seqDB search
MKSYDVIVIGAGVVGASVAFHLAALGARNVLVLDRGAIGAGTTAQSSGILRTHYSVRENV
ELARRSWGAFTDFAAYVGDDDAASGLVRCGYLIAAADDDKRAPLAAALAQQRALGIPVHE
LDAAQARELLPIADFGDAALIGFEPEAGFADAYLVATSFARAARRRGVTIRENVAVHGLL
TRNGRVTGVTTSAGDYASAVVVSTQNIWTAELAAWTGVAMPLAPERHAVLALQCAAAPYT
YTMPVYKDLASPGMLYCRSYGGNQMLVSEGTEGERLAPGEVEQGDVPLDYVAEVGEQVAA
RFPAYAEAGLAASWTGVYDVTPDWNPVLGRIAGVEGLVAGFGFSGHGFKLSPAVGRVLAQ
EALGLATDVPLAPYALARFTRGALLTGSYGRGAVS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttatgacgtgatcgtgatcggcgccggcgtggtcggcgcctcggtcgccttc
cacctggcggccctgggcgcccgcaacgtgctggtgctggaccgcggcgccatcggcgcc
ggcaccaccgcgcaatcgtcgggcatcctgcgcacccattactcggtgcgcgagaacgtc
gaactggcgcggcgttcgtggggcgcgttcaccgactttgccgcctacgtcggcgacgac
gacgccgccagcggcctggtgcgctgcggctacctgatagccgcggccgacgatgacaag
cgcgcgccgctggccgcggcgctggcgcagcagcgcgcgctgggcatcccggtgcacgaa
ctggacgcggcgcaggcgcgcgagctgctgccgatcgccgatttcggcgatgccgcgctg
atcggcttcgagcccgaggccggtttcgccgacgcctacctggtcgcgaccagcttcgcg
cgcgccgcgcgccggcgcggcgtgacgatccgcgagaacgtggccgtgcacggcctgctg
actcgaaacgggcgcgtgaccggcgtgaccacgtcggcgggcgactacgccagcgcggtg
gtggtcagcacccagaacatctggaccgccgaactggcggcctggaccggcgtggcgatg
ccattggcgcccgagcgccacgcggtgctggcgctgcaatgcgccgccgcgccctatacc
tacacgatgcccgtctacaaggacctggcctcgcccggcatgctctattgccgcagctat
ggcggcaaccagatgctggttagcgagggcacggagggcgaaaggctggcgccgggagag
gtggagcagggcgatgtgccgctggattacgtggccgaggtcggcgaacaggtggccgcg
cgttttccggcctatgccgaggccggactggccgcgtcgtggacgggcgtgtacgacgtc
acgcccgactggaatcccgtgctgggacgtatcgccggggtcgaagggctggtggccgga
ttcggtttttccggacatggtttcaagctgtcgccggcggtggggcgggtgctggcgcag
gaagcgctggggctggcgaccgacgtccccctggcgccgtatgcgctggcgcgtttcacg
cgcggcgcgctgctgacgggcagctatgggcgcggcgcggtgtcgtga

DBGET integrated database retrieval system