KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_044091Help
Entry
NH44784_044091    CDS       T02785                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00564  Glycerophospholipid metabolism
axo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NH44784_044091
Enzymes [BR:axo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NH44784_044091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_2 GIDA FAD_binding_3 Thi4 Pyr_redox_3 Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CCH08352
LinkDB All DBs
Position
complement(4696408..4698006)
Genome map
AA seq 532 aa AA seqDB search
MNQPLATVTPPDRNRLLAQLDNTPAWDVIVIGGGATGLGTAVDAASRGYRTLLIEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYNLLDQP
FYGVGLKMYDMLAGKLNLSPSRWLSRRETLANAPTLAENVNGRGLKGGVLYYDGQFDDAR
LALSLMRTLFDLGGTAVNYVRATGLTTTGGKVDGVTAEDALGGASFTLRARCVINATGVW
VDSVRRMEDKNAPTMVAPSQGVHLTLPHDFLPGKRAILIPKTDDGRVLFVVPWNGHTIVG
TTDSPRNDLPLDPEAGAEDVDFILNTAARYLSRKPTRDDVTSVWAGLRPLVKATGDASTK
SLSREHTILVSQAGLVTVTGGKWTTYRRMAQDVVDTAIQHQLLTQASCRTESLALHGANG
LAPSQEHAGTPDSYYGSDLATLKALPGAERMLVRSSGLSEAHVRFAARFELARSAEDVLA
RRNRALFLDAEAAMLAAPEVARLLAEELGHDAAWQQRTLQELAGVAAHYRLK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaccgctcgccaccgtcaccccgcccgaccgcaaccgcctgctggcgcaactg
gacaacacgcctgcctgggacgtgatcgtcatcggcggcggcgcgaccggcctgggaacc
gccgtcgacgccgccagccgcggctaccgcacgctgctgatcgaggccgccgacttcgcc
aagggcacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcgcaa
ggcaacatcagcctggtgcgcgaggccctgcacgaacgcggcctgctcaaccgcaacgcg
ccacacctggtgtggccgctgggcttcgtggtgccggcctacaacctgctggaccagccg
ttctacggcgtgggcctgaagatgtacgacatgctggccggcaagctcaacctgtcgccc
agccgctggctgtcgcgccgcgagacgctggccaacgcaccgacgctggccgaaaacgtc
aacggccgcggcctgaagggcggcgtgctgtactacgacggccagttcgacgacgcgcgc
ctggcgctgagcctgatgcgcaccctgttcgacctgggcggcacggcggtcaactacgtg
cgcgccaccggcctgaccaccaccggcggcaaggtcgacggcgtcaccgccgaggacgcg
ctgggcggcgccagcttcacgctgcgcgcgcgctgcgtgatcaacgccaccggcgtctgg
gtcgacagcgtgcgccgcatggaagacaagaacgcgcccaccatggtggcgcccagccag
ggtgtgcacctgacgctgccgcacgacttcctgcccggcaagcgcgccatcctgatcccc
aagaccgacgacggccgcgtgctgttcgtggtgccgtggaacggccacaccatcgtcggc
accaccgattcgccgcgcaacgacctgccgctggacccggaagccggcgccgaggacgtc
gacttcatcctgaacaccgccgcgcgctatctcagccgcaagccgacccgcgacgacgtc
accagcgtctgggcgggcctgcggccgctggtcaaggccaccggcgacgcctccaccaag
tcgctgtcgcgcgagcacaccatcctggtgtcgcaggcggggttggtgacggtcacgggc
ggcaagtggaccacctatcgccgcatggcgcaggacgtggtcgacaccgccatccagcac
cagttgctgacgcaggccagctgccgcaccgagtcgctggcgctgcatggcgccaacggc
ctggcgccgtcgcaggaacacgccggcacgccggacagttactacggcagcgacctggcc
acgctcaaggccctgcccggcgccgagcgcatgctggtcaggagcagcggcctgtcggaa
gcgcatgtgcgtttcgccgcgcgcttcgaactggcgcgcagcgccgaggacgtgctggcg
cgccgcaaccgcgcgctgttcctggacgccgaggcggccatgctggccgcgcccgaagtg
gcgcgcctcctggccgaggaactgggccacgacgccgcctggcagcagcgcacgctgcag
gaactggccggcgtggcggcgcactatcgactgaaatga

DBGET integrated database retrieval system