KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_059311Help
Entry
NH44784_059311    CDS       T02785                                 

Definition
(GenBank) Xanthine and CO dehydrogenases maturation factor,XdhC/CoxF family
  KO
K07402  xanthine dehydrogenase accessory factor
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Brite
KEGG Orthology (KO) [BR:axo00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    NH44784_059311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XdhC_C XdhC_CoxI
Motif
Other DBs
NCBI-ProteinID: CCH09872
LinkDB All DBs
Position
complement(6376163..6377176)
Genome map
AA seq 337 aa AA seqDB search
MESVDVRVLRAARDWAMAGERVLLATVARTWGSSPRPTGSMMALREDGRCVGSVSGGCIE
DDLVLRYTRAHGGAGMPRATPELVRYGVHADDAHRFGLPCGGTLELLLEFDPDVAALDTL
VRQLESGQLVRRSVDCATGAVTQAPASAPQALHFDGATLSSTLGPQYRMLLIGAGALAEY
VATMALFNDFAVTLCDPRVEHLGAWSVQGVRLTTEMPDDAVRAMRPDTRTCIVALSHDPK
LDDLALLEALHSPAFYVGAIGSRRNTDLRRQRLIEHFDETEESLKRLRAPVGLYIGSRTP
AEIAVSVMAEILAVKNGVALPATLSVAVAKTHEPRAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgtggatgtacgcgtgttgcgcgccgcgcgcgactgggccatggcgggagag
cgggtgttgctggccacggtggcgcgcacctggggatcgtcgccgcgcccgacgggttcg
atgatggcgctgcgcgaggacggccgctgcgtcggctcggtttcgggcggctgcatcgag
gacgatctggtgctgcgctatacccgcgcccacggcggcgcgggcatgccgcgcgcgacg
ccggaactggtgcgctatggcgtccacgccgacgatgcgcaccgcttcggcctgccttgc
ggcggcaccctggaactgctgctggagttcgatcccgacgtcgccgcgctggacacgctg
gtgcggcagctggaatccgggcagctggtccggcgcagcgtcgactgcgcgacgggcgcg
gtgacgcaggcgccggcttcggcgccgcaggccctgcatttcgatggcgccaccctgtcc
agcacgctggggccgcagtaccgcatgctgctcatcggcgccggcgcgctggccgagtac
gtcgcgaccatggcgctgttcaacgatttcgcggtcacgctttgcgatccgcgcgtcgag
cacctgggcgcctggtcggtgcagggcgtgcgcctgaccaccgagatgcccgatgatgcc
gtgcgcgccatgcgtccggacacgcgcacctgcatcgtggcgctgagccacgatcccaag
ctggacgacctggcgttgctggaggcgctgcacagcccggccttctatgtcggcgcgatc
ggctcgcggcgcaacaccgacctgcgccggcagcggctgatcgagcatttcgacgagacc
gaggaatcgctcaagcgcctgcgggcgccggtgggcctttacatcggcagccgcacgccg
gcggagatcgccgtcagcgtcatggccgagatcctggccgtcaagaatggcgtggccttg
cccgccacgctctcggtggccgtcgccaagacgcacgaaccgcgcgccgcctag

DBGET integrated database retrieval system