KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_059781Help
Entry
NH44784_059781    CDS       T02785                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00500  Starch and sucrose metabolism
axo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NH44784_059781
Enzymes [BR:axo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NH44784_059781
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     NH44784_059781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: CCH09919
LinkDB All DBs
Position
6419752..6423066
Genome map
AA seq 1104 aa AA seqDB search
MVYQLHVKSFFDSNDDGVGDLPGLISKLDYIANLGVDTIWLLPFYPSPRRDDGYDIADYR
GVHPDYGTVADVRKLIRAAHARGLRVITELVVNHTSDQHPWFQRARTSRPGSAARNFYVW
SDNDKAYAGTRVIFCDTEKSNWTWDPVANAYFWHRFYSHQPDLNYDNPQVLKEVLAVMRH
WLDMGVDGLRLDAVPYLVEREGTNNENLPETHQVLKRIRAVIDSEYPGRLLLAEANQWPE
DAQEYFGNGDECHMSFHFPLMPRMYMAIAQEDRFPITDIIRQTPDIPATCQWAIFLRNHD
ELTLEMVTSRERDYLWSVYAADPRARINLGIRRRLAPLLERDRRRVELMNSLLLSMPGTP
VLYYGDELGMGDNVHLGDRDGVRTPMQWSPDRNGGFSRADPERLPLPVLMGPLYGYEAVN
VEAQQRDPHSLLNWTRRMLAQRRQTHAFGRGTLRFIQAGNRKILAYLRQWRDTTILCVAN
LSNAAQPVELPLQAFNGRVPVEMLGGTPFPAIGELPYLLTLPPYGFYWMDLSAEAAPPGW
HASAPERMPELVTLVLRGHANAVLTDGSRQTLETEVLPEYLARQRWFPGATPPARASLAY
ATPFGAGRAESSGAGTTEYYWAEAEPADAAVARRVQIPFALVWDEAAQVQYPIARVRRGP
EVGILADAFLQPGFVLGVVDALRHGREWDGRQGGKPGERPGVIRSLPEPGMTELALDAEP
ALQWISGEQSNSSVVIGGKAILKLLRNAPPGLSAEVEMSRHLTRAGYANIPALLGEIQRV
DGDGVPCTLAVLYAYIANEGDAWNWTLDYLKRTLATALLGGDSPEEFEASLEGYATQAAT
IGRRLAQLHQVLARPSDDPAFAPAIASQEEADALAARVVGQLDQAAQALRACVDSLEEPS
RACAQWLFDHHGRLVARIERMAQALAGSPLIRVHGDLHLGQVLVAQTDAYLIDFEGEPDQ
PLSLRRQLASPAKDVAGMLRSFDYAAAAVARHDPLGGAPTDANAAPMENAATANSPAQLR
DALLARFRARATEAFLQGYEEAGAAPSPAWRTLLQLAQLEKAAYEIGYEAGHRPDWISIP
LCALSGLAHALVQNAAIDAEDPTP
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
gtggtctaccaactgcatgtgaagtcgttcttcgattccaacgacgacggcgtgggcgac
ctgcccgggctgatttccaagctcgactacatcgccaacctgggcgtcgatacgatctgg
ctgctgcccttctacccctcgccgcgacgcgacgacggctacgacatcgccgactaccgc
ggcgtgcacccggactacggcacggtcgccgacgtgcgcaagctgatccgagcggcccac
gcgcgcggcctgcgcgtcatcaccgagctggtggtcaaccatacctccgaccagcatccg
tggttccagcgggcgcgcacctcgcggcccggctcggcggcgcgcaatttctacgtatgg
tcggacaacgacaaggcctacgccggcacccgcgtgatcttctgcgacaccgagaagtcc
aactggacctgggacccggtggccaacgcctacttctggcaccgcttctactcgcaccag
cccgacctgaactacgacaacccgcaggtgctcaaggaagtgctggcggtgatgcgccac
tggctggacatgggcgtggacggcctgcggctggacgccgtgccctacctggtcgagcgc
gagggcaccaacaacgagaacctgcccgagacccaccaggtgctcaagcgcatccgcgcc
gtcatcgacagcgagtatccgggccgcctgctgctggccgaggccaaccagtggcccgag
gacgcgcaggagtatttcggcaatggcgacgaatgccacatgtcgttccacttcccgctg
atgccgcgcatgtacatggcgatcgcgcaggaagaccgctttcccatcaccgacatcatc
cggcagacgcccgacatccccgccacctgccagtgggccatcttcctgcgcaaccacgac
gaactgacgctggagatggtcaccagccgcgaacgcgactacctctggagcgtctacgcg
gccgatccgcgcgcccgcatcaacctgggcatccgccgccgcctggcgccgctgctggaa
cgcgaccggcggcgggtcgaactgatgaacagcctgctcttgtcgatgcccggcacgccg
gtgctgtactacggcgacgaactgggcatgggcgacaacgtgcacctgggggaccgcgac
ggcgtgcgcacgccgatgcaatggtcgcccgaccgcaacggcggcttctcgcgcgccgac
cccgaacggctgccgctgccggtgttgatggggccgctgtatggctatgaggccgtcaac
gtcgaggcccagcagcgcgacccgcactcgctgctgaactggacccgccgcatgctggcg
cagcgccgccagacccacgccttcggccgcggcacgctgcgcttcatccaggccggcaat
cgcaagatcctggcctacctgcggcaatggcgcgacaccaccatcctgtgcgtggccaac
ctgtccaacgccgcccagccggtcgaactgccgctgcaggccttcaacggccgcgtgccg
gtggagatgctgggcggcacgccgtttcccgcgatcggcgagctgccctacctgctgacg
ctgccgccctatggcttttactggatggacctgagcgccgaggcggctccgcccggctgg
cacgcgagcgcgccggaacgcatgccggagctggtcacgctggtgttgcgcggccatgcc
aacgccgtcctcacggatggctcgcgccagaccctggaaaccgaagtgctgccagaatac
ctggcgcgccagcgctggttccccggcgccacgccgcccgcccgggcgtcgctggcctac
gccacgcccttcggcgccggccgggccgaatcctccggcgccggcactaccgaatactac
tgggccgaagccgagccagccgacgccgcggtcgcgcggcgggtgcagatcccgttcgcg
ctggtctgggacgaggccgcgcaagtgcagtacccgatcgcgcgcgtgcggcgcggccct
gaagtcggcatcctggccgatgccttcctgcagcccggcttcgtgctgggggtggtcgac
gccctgcgccacggccgcgaatgggatggccggcaaggcggcaagccgggcgagcggccc
ggcgtgatccgcagcctgcccgaacccggcatgacggaactggcgctggacgccgaaccg
gcgctgcaatggatcagcggcgagcagtccaacagttcggtggtgatcggcggcaaggcc
atcctgaaactgctgcgcaatgccccgccggggctgtcggcggaagtcgagatgagccgc
cacctgacccgcgcgggctatgccaacatccccgcgctgctgggcgaaatacaacgcgtg
gacggcgatggcgtgccctgcacgctggcagtgctgtacgcctacatcgccaacgaaggc
gacgcctggaactggacgctggactacctgaagcgcacgctcgccacggcgctgctgggc
ggcgacagccccgaggaattcgaagccagcctggaaggctatgccacccaggccgccacc
atcggccggcgcctggcgcaattgcaccaggtgctggcgcggcctagcgacgatccggcg
ttcgccccggccatcgcgtcgcaggaagaggccgatgccctcgccgcgcgcgtcgtgggc
cagctcgatcaggccgcccaggcgctgcgcgcctgtgtcgacagcctggaggaaccttcg
cgggcctgcgcccaatggctgttcgaccaccacggccgcctggtggcgcggatcgagcgc
atggcgcaagccctcgccggcagcccgctgatccgcgtccatggcgatctgcatctgggc
caggtgctggtggcgcagaccgatgcctacctgatcgacttcgagggcgaacccgaccag
ccgctgtccctgcgccggcaactggcctcgcccgccaaggacgtggccggcatgctgcgg
tcgttcgactacgcggccgccgccgtggcgcgccacgatccgctgggcggcgcccccacc
gacgccaacgcggcgccgatggaaaacgccgccaccgcgaattcgccggcgcagctgcgc
gatgcgttgctggcgcgctttcgcgcccgcgccaccgaggccttcctgcaaggctacgag
gaagccggagccgcgccgtcgccggcctggcgcaccctgctgcaactggcccaactggaa
aaagccgcctacgagatcggctacgaggccggccaccgccccgactggatctccattccg
ctgtgcgcgctgtccggcctggcgcatgcgctggtgcagaacgcggcgatcgacgccgag
gacccgacgccatga

DBGET integrated database retrieval system