KEGG   Achromobacter xylosoxidans C54: LH59_13735Help
Entry
LH59_13735        CDS       T03336                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
axs  Achromobacter xylosoxidans C54
Pathway
axs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:axs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LH59_13735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:axs02000]
    LH59_13735
Enzymes [BR:axs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LH59_13735
Transporters [BR:axs02000]
 Other Transporters
  Pores ion channels [TC:1]
   LH59_13735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_3 GST_N_3 GST_C GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AIR51778
LinkDB All DBs
Position
complement(2974783..2975409)
Genome map
AA seq 208 aa AA seqDB search
MSRWTFYTAPGTCALATHIALQEAGAEFDVVKLDFGAGQQQSPEFLRVNPKGRVPALATE
HGVLTETPALLAFVAQRFPAAGLAPLDDPFAFARLQELNSYLASTAHVAHAHKRRGARWA
DDPAAHEAMRAKVPETMTAVAAYLESQIAGPWALGERFSVADAYLYTIGSWLEGDGVDLA
RFPALTAYLARVAARPAVQRALAQAKAE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgttggaccttctataccgcgccgggcacctgcgccctggccacccacatcgcc
ttgcaggaagccggcgccgaattcgacgtcgtcaagctggatttcggcgcgggccagcag
cagagcccggaattcctgcgcgtcaatcccaaggggcgggtgccggcgctggccaccgag
catggcgtgctgaccgagaccccggcactgctggcgttcgtcgcgcagcgcttcccggcg
gccgggctggcgccgctggacgatccgttcgcgttcgcgcgcctgcaggaactgaacagc
tacctggcgtccaccgcccacgtggcgcatgcgcacaagcggcgcggcgcgcgctgggcc
gacgacccggcggcgcacgaggccatgcgcgccaaagtgccggaaaccatgacggccgtg
gccgcctacctggaatcgcagatcgccgggccgtgggcgctgggcgaacgcttcagcgtg
gccgacgcctatctctacaccatcggcagctggttggagggcgacggcgtggatctggcg
cgcttcccggcgctgaccgcctacctggcgcgggtcgcggcgcgcccggcggtgcagcgc
gcgctggcgcaagccaaggccgaataa

DBGET integrated database retrieval system