KEGG   Achromobacter xylosoxidans C54: LH59_19425Help
Entry
LH59_19425        CDS       T03336                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
axs  Achromobacter xylosoxidans C54
Pathway
axs03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:axs00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    LH59_19425 (ligD)
Enzymes [BR:axs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LH59_19425 (ligD)
DNA repair and recombination proteins [BR:axs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     LH59_19425 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIR52828
LinkDB All DBs
Position
complement(4251721..4254327)
Genome map
AA seq 868 aa AA seqDB search
MADTLAKYRAKRNFNVTSEPAEGGQANEAARAFVIQKHWASRLHYDFRLELDGAMKSWAV
PKGPSYDPSVKRMAVQVEDHPIAYNRFEGEIPKGQYGAGKVIIWDRGTWAPVGDPAEGYR
RGHLKFDLHGVKMRGRWALIRMKGRESEKQPPWLLVKDRDEHARAESEFSVVDEQPDSVA
TPPRTGARAVPAAAPGARPDAAASPTSPPESGAGASDLPGEAAPLPELLKPQLATLVEGV
PRQAGDDWIYEMKFDGYRLLARLRGGQVRLYTRNGHDWGPKLPHLVRALQRLPLPDAWID
GEIVMLADNGAPSFQALQNAFDGERTDGILFYAFDLPYVTGRDLRQEPLRVRRAVLARVM
EAAGGDPLRFSEAFDAAPADLVASACKMGLEGIIAKRLSAPYVSRRSDSWVKLKCARRQE
FVIAGYTDPKGARVGLGALLLAYHDEDGGLVYAGKVGTGFDDMGLAALQRRLSALETERP
AVKAAGVGRGVHWVRPELVAEVSFGEWTAAGHVRHPVFRGLRTDKPARAITREAAMGADT
MQSDDTAGKTGKAKTGKAKAGSAQTGKAKAGKAQPGAGKLTHPERIIDPSTGLTKLDLAR
YDGLVAPLLLRHLKDRPVSFLRAPSGLKGEFFFQKHLEAPMPGVRPLPQELDPDHPPLME
VPTPQAIMSAAQMNVVEFHTWNAVKSAIDKPDRMLFDLDPGEGVAWPSMQQAARLVHVML
REIGLRSWLKTSGGKGLHVVVPLRRQYDWDTVKAFSQAIVQHLARTLPQVFVAKSGPKNR
VGRIFADYLRNGFGATTVAAWSARARPGMGVSVPLAWDELDEVRASDQWTIANIHERLDV
GDSPWDDYAPQALGAAMKAMDFKPDSGG
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggccgataccctggcgaaataccgcgccaagcgcaatttcaatgtgacgtcggagccg
gccgaaggcggccaggccaacgaggcggcgcgcgccttcgtgatccagaagcactgggcc
agccgcctgcactacgacttccggctggaactggatggcgccatgaagagctgggccgtg
cccaagggacccagctatgacccgtcggtcaagcgcatggccgtgcaggtggaagaccat
cccatcgcctacaaccgcttcgagggcgagatccccaagggccagtacggcgccggcaag
gtgatcatatgggatcgcggcacctgggcgccggtgggcgatccggccgagggctacagg
cgcggccatctcaagttcgacctgcatggcgtcaagatgcgtggacgctgggcgctgatc
cgcatgaagggccgcgagtcggaaaagcagccgccctggctgctggtcaaggaccgcgac
gaacacgcccgcgccgaaagcgaattcagcgtggtggacgagcagcccgacagcgtggcc
acgccgccgcggacgggcgcgcgggccgtgcccgccgcggcgcccggggcgcggccggat
gcggccgcgtcgccgacgtcgccgccggagtcgggcgccggggcatcggacctgccgggc
gaggcggcgcccttgccggagttgctcaagccgcaattggccacgctggtggaaggcgtg
ccgcgccaggccggcgatgactggatctacgagatgaagttcgacggttaccgtctgctg
gcgcggctgcgggggggccaggtgcgcctatacacgcgcaacggccatgactgggggccg
aagctgccgcacctggtgcgggcgttgcagcgcctgccgctgcccgacgcctggatcgac
ggcgagatcgtgatgctggccgacaacggcgcgcccagcttccaggcgctgcagaatgcc
ttcgacggcgaacgcaccgacggcatcctgttctacgcgttcgacctgccctacgtcacc
ggccgcgacctgcgccaggagccgctgcgcgtgcgtcgcgcggtgctggcgcgggtcatg
gaggccgccggcggcgatccgctgcgcttcagcgaagccttcgacgcggcgccggcggac
ctggtggcctcggcctgcaagatggggctggagggcatcatcgccaagcgcctgtccgcg
ccctacgtatcgcgccgcagcgatagctgggtcaagctcaagtgcgcccgccggcaggaa
ttcgtcattgccggctataccgatcccaagggcgcgcgggtggggctgggcgcgctgctg
ctggcgtaccacgacgaggacggcgggctggtctacgccggcaaggtcggcaccggcttt
gacgacatgggcctggcggcgctgcaacgccgcctgagcgccctggaaacggagcggccc
gccgtcaaggcggccggcgttggccgcggcgtccattgggtgcggcccgagctggtggcg
gaagtgtcgttcggcgaatggaccgctgcggggcatgtgcgccacccggtcttccgcggc
ttgcgcaccgacaagccggcgcgggcgatcaccagggaggcggcgatgggggccgatacg
atgcagtccgacgatacggccggcaagaccggcaaagccaagaccggcaaggccaaggcg
ggcagcgcccagactggcaaggccaaggcgggcaaggcccagccaggcgccggcaagctg
acccaccctgaacgcatcatcgatccgtccacggggctgaccaagctggacctggcgcgc
tacgacgggctggtggcgccgctgctgctgcggcatctgaaggaccggcccgtttccttt
ctgcgcgccccgtccggcctgaagggcgagttctttttccagaagcacctggaggcgccg
atgccgggcgtgcggccgctgccgcaggaactggacccggatcatccgcccttgatggag
gtgccgacgccgcaggcgatcatgtcggcggcgcagatgaacgtagtcgagttccacacc
tggaacgcggtgaaaagcgcgatcgacaagcccgaccgcatgttgttcgacctggacccg
ggcgaaggggtggcctggccgtcgatgcagcaggcggcgcggctggtccacgtgatgctg
cgcgaaatcggtttgcgaagctggctcaagaccagcggcggcaagggcctgcacgtggtg
gtgccgctgcgccggcaatacgactgggacacggtcaaggcgttctcgcaggccatcgtc
cagcatctggcgcgcacgctgccgcaggtgttcgtggccaagagcgggccgaagaaccgc
gtcggccggatcttcgccgattacctgcgcaacggcttcggcgccaccacggtggcggcc
tggtcggcgcgcgctcggccagggatgggggtgtcggtgccgctggcgtgggacgagctg
gacgaggtccgggccagcgaccagtggaccatcgccaatatccatgagcgcctggatgtc
ggcgactcgccgtgggacgactacgccccgcaggcgctgggcgcggccatgaaggcgatg
gacttcaagccggattcgggcgggtag

DBGET integrated database retrieval system