KEGG   Achromobacter xylosoxidans C54: LH59_21480Help
Entry
LH59_21480        CDS       T03336                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
axs  Achromobacter xylosoxidans C54
Pathway
axs00440  Phosphonate and phosphinate metabolism
axs01100  Metabolic pathways
axs01120  Microbial metabolism in diverse environments
axs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:axs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    LH59_21480
Enzymes [BR:axs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     LH59_21480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: AIR53210
LinkDB All DBs
Position
complement(4690195..4691067)
Genome map
AA seq 290 aa AA seqDB search
MHRHARFRQKLQAPVLMHAMSAHNPLSAKLAAEAGFDAIWGSGFELSASHAVPDANILSA
GLHLEMMRAIAAVVDVPVIADIDTGFGNAINVAYVVPQYEAAGVSAVVMEDKTFPKDTSL
RADGRQELVRVAEFQGKIEAACAARRDADFCVIARTEALIAGLGQAEALARAAAYEAAGA
DAILIHSKQTTPDEVLAFIAAWSGRVPLVLVPTAYPQLREADIQALGKVGLVIYGNHAIR
AAVGTMREVFARIRKDGGIHGVDAGLPTVRDIIDLQGDADMRELERRFLR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgccacgcacgctttcgccagaaattgcaggctcccgtcctgatgcacgccatg
tcggcgcacaacccgctgtcggccaagttggcggccgaggcgggcttcgacgcgatctgg
ggcagcggcttcgaactgtcggccagccatgcggtgccggacgccaacatcctgtcggcc
gggctgcacctggagatgatgcgggccatcgcggcggtggtcgatgtgccggtcatcgcc
gatatcgatacggggttcggcaacgccatcaatgtcgcctatgtcgtgccgcaatacgaa
gcggcgggcgtatcggccgtggtcatggaagacaagacctttcccaaggacaccagcctg
cgcgccgatggccgccaggaactggtgcgcgtcgcggaattccagggcaagatcgaggcc
gcctgcgcggcgcgtcgcgatgcggatttctgcgtcattgcccgcaccgaggcgctgatc
gccgggctcggccaggccgaggcgctggcgcgcgcggcggcctacgaggccgccggcgcc
gatgccatcctgatccattccaagcagaccacgcccgacgaggtgctggccttcatcgcg
gcctggtccggccgcgtgccgctggtgctggtgccgaccgcctatccgcaattgcgcgag
gccgatatccaggccctgggcaaggtggggttggtgatctacggcaatcacgcgatccgc
gccgccgtgggcaccatgcgcgaggtgttcgcccgcatccgcaaggacggcggcatccat
ggcgtcgatgccggcctgcccacggtgcgcgatatcatcgacctgcagggcgatgcggac
atgcgcgaactggagcgcaggttcctgcgctga

DBGET integrated database retrieval system