KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_02124Help
Entry
ERS451415_02124   CDS       T04522                                 

Gene name
mrcA_1
Definition
(GenBank) Penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00550  Peptidoglycan biosynthesis
axx01100  Metabolic pathways
axx01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:axx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ERS451415_02124 (mrcA_1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ERS451415_02124 (mrcA_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:axx01003]
    ERS451415_02124 (mrcA_1)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:axx01011]
    ERS451415_02124 (mrcA_1)
Enzymes [BR:axx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ERS451415_02124 (mrcA_1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ERS451415_02124 (mrcA_1)
Glycosyltransferases [BR:axx01003]
 Polysaccharide
  Bacterial polysaccharide
   ERS451415_02124 (mrcA_1)
Peptidoglycan biosynthesis and degradation proteins [BR:axx01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ERS451415_02124 (mrcA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: CKH21057
UniProt: A0A0D6H7D1
LinkDB All DBs
Position
1:complement(2331312..2333996)
Genome map
AA seq 894 aa AA seqDB search
MSTPQQSSATPGGKSGFPWKRLLIKAGVAVAGLGVCGALLVGLALAIAWPSLPDLHAMTD
YRPRVPLRIYTADKVLIGEYGEEHRNVLRFDEIPAVMRQAVLAAEDDRFYQHGGVDWMGM
VRAVLVNLVKQSKTQGGSTITMQVARNFYLSSEKTYSRKFYELLLTYKIESELTKDQILE
LYMNQIYLGHRAYGFAAASRTYLGKPLSEVTPAEAAMLAGIPKAPSRFNPITNFPRAEIR
QHYVLGRMKTLGYLTPEQTEEALKQHVVIRGADGASLRGFAIHGEYPAELARQLMYGVFQ
EQTYSKGIDVYTTIDSKDQEAAYRAVRDGVLDYTRRAPYPGPEDQIDLPDGVEKDAAAFD
DILDGVQEKTPDSEDLLTAVVLAASPQEVTVARSAREIITISDKKALAVVARALNPKASD
SQRIQRGSVVYIHKNGDGWEIINMPALQAALVSMVPQDGAIRAMIGGFDYNRGTFNRVTQ
AWRQPGSNIKPFVYAAALERGLTPATQVSDQPFMLTAAQTGSKDWQPKNDGNRYEPMLTL
RQGLYKSKNMVTIRILQAIGPQYAQDYLTRFGFDKARWPAVLPLGLGAGGATPLQVVNGY
SVFANGGYRVTPYLIDKVTDRSGNVLMQAQPVVAGDAAARAIDPRTAWVMDDILRGVTTS
GTAARAHQVLKRNDIGGKTGTTNEAVDVWFSGFTPSLATTVWMGFDQPKSLGTNEFGSGL
ALTTWLDYMQPALKGVPEAKPAPRPDGLLVDNGEYYFNEFPPGQAVASLDLSSGDPLTDF
LNNNRSTDGVDNSVRPLPVPGAAQPPATPPQAGAPQPARQVPTQQVPAQQAPVAQPIPVP
AAGGGALGGTLGGGAGNAPPIPPIPVPRVEADPVAGPRASVVSGGDGPLAARPL
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccccagcaatcctccgccaccccgggcggcaaatcgggctttccctggaaa
cgactcctgatcaaggccggcgtcgccgtcgccggcctcggtgtctgcggggcgctgttg
gtcggcctggcgctggcgatcgcctggcccagcctgcccgacctgcacgccatgaccgac
taccggccgcgggtgccgctgcgcatctataccgccgacaaggtcctcatcggcgaatac
ggcgaagaacaccgcaacgtgctgcgcttcgacgagatcccggcggtgatgcgccaggcg
gtgctggcggccgaggacgaccgcttctaccagcatggcggcgtcgactggatgggcatg
gtgcgcgccgtgctcgtgaacctcgtcaagcaatccaagacccagggcggcagcacgatc
accatgcaggtggcgcgcaacttctacctgtcgtccgaaaagacctattcgcgcaagttc
tacgaactgctgctgacctacaagattgaatccgagctcaccaaggaccagatcctcgag
ctctacatgaaccagatctacctgggtcaccgcgcctatggcttcgccgccgcctcgcgc
acctacctgggcaagccgctgtccgaagtcacgccggccgaggccgcgatgctggccggc
attcccaaggcgccttcgcgcttcaaccccatcaccaatttcccgcgcgccgagatccgc
cagcactacgtgctgggccgcatgaagacgctgggctacctgacgccggaacagaccgaa
gaagccctcaagcagcacgtagtgatccgcggcgccgacggcgccagcctgcgcggcttc
gccatccacggcgaatacccggccgaactggcgcgccagctgatgtacggcgtgttccag
gagcagacctactccaagggcatcgacgtctacaccacgatcgactccaaggaccaggaa
gcggcctaccgcgccgtgcgcgacggcgtgctggactacacccggcgcgcgccctacccc
ggcccggaagaccagatcgacctgcccgacggcgtcgaaaaggacgccgcggcgttcgac
gacatcctcgacggcgtgcaggaaaagacgcccgacagcgaagacctgctgaccgccgtg
gtgctggccgccagcccgcaggaagtgaccgtggcgcgcagcgcgcgcgagatcatcacc
atctccgacaagaaggcgctggcggtggtggcgcgcgccctcaaccccaaggccagtgac
agccagcgcatccagcgcggctcggtggtctacatccacaagaacggcgacggctgggaa
atcatcaacatgccggcgctgcaggcggcgctggtgtcgatggtgccgcaggacggcgcc
atccgcgccatgatcggcggcttcgactacaaccgcggcaccttcaaccgcgtcacgcag
gcctggcgccagccgggctcgaacatcaagccgttcgtgtacgccgcggccctcgaacgc
ggcctgacgccggccacccaggtgtccgaccagcccttcatgctgaccgccgcgcagacc
ggctcgaaggactggcagcccaagaacgacggcaaccgctatgaacccatgctgaccctg
cggcagggcctgtacaagtccaagaacatggtcaccatccgcatcctgcaggccatcggc
ccgcagtacgcgcaggactacctgacccgcttcggcttcgacaaggcccgctggccggcg
gtgctgccgctgggcctgggcgccggcggcgccacgccgctgcaggtggtcaacggctac
agcgtgttcgccaacggcggctaccgcgtcacgccctacctgatcgacaaggtcaccgac
cgctcgggcaacgtgctgatgcaggcgcagccggtggtggcgggcgacgccgccgcgcgc
gccatcgacccgcgcaccgcctgggtcatggatgacatcctgcgcggcgtcaccaccagc
ggcaccgcggcgcgtgcgcaccaggtgctcaagcgcaacgacatcggcggcaagaccggc
accaccaacgaggcggtcgacgtctggttctccggcttcacccccagcctggccaccacg
gtctggatgggctttgaccagcccaagtcgctgggcaccaacgaattcggcagcggcctg
gccctgaccacctggctcgactacatgcagccggcgctcaagggcgtgcccgaggccaag
ccggcgccgcgtcccgacggcctgctggtggacaacggcgaatactatttcaacgaattc
ccgccgggccaggcggtggcctcgctcgacctgtccagcggcgacccgctgaccgacttc
ctcaacaacaaccgctccaccgacggcgtcgacaactcggtccggcccctgcccgtgccc
ggcgcggcgcagccgccggccaccccaccgcaggcgggcgcgccgcaaccggcccggcag
gtgccgacgcaacaggtgccggcccagcaggcgccggtggcgcagccgattcccgtgccg
gccgccggcggcggcgcgctgggaggcacgctgggcggcggcgccggcaatgcccccccg
atcccgccgattccggtgccacgcgtcgaggccgacccggtggccggcccccgcgccagc
gtcgtcagcggcggcgacgggccgctggcggcgcggccgctctag

DBGET integrated database retrieval system