KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_04573Help
Entry
ERS451415_04573   CDS       T04522                                 

Gene name
ompR_4
Definition
(GenBank) Transcriptional regulatory protein OmpR
  KO
K02483  two-component system, OmpR family, response regulator
Organism
axx  Achromobacter xylosoxidans NCTC10807
Brite
KEGG Orthology (KO) [BR:axx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:axx02022]
    ERS451415_04573 (ompR_4)
Two-component system [BR:axx02022]
 OmpR family
  Unclassified
   ERS451415_04573 (ompR_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CKH96939
UniProt: A0A0D6ICM2
LinkDB All DBs
Position
1:5029034..5029771
Genome map
AA seq 245 aa AA seqDB search
MDNPDHILIVDDDREIRELAGNFLKKNGLNVTLAADGRQMRNLLETLTVDLIVLDIMMPG
DDGLVLCRELRAGKHRRTPILLLTARDEDMDRVLGLEMGADDYLVKPFVARELLARIKAI
LRRTRMLPPNFQVTEPGRAVRFGAWTLDTTARHLLDAEGTIVSLSGAEYRLLRVFLDHPQ
RVLNRDQLLNLTQGRDADFFGRSIDLLVSRLRQRLREDAREPMYIKTVRSEGYVFAAQVD
VSEAT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggacaatccagaccacatcctgatcgtcgacgacgaccgcgagatccgcgagctggcc
ggcaacttcctcaagaagaacggcctgaacgtcacgctggcggccgatggccggcagatg
cgcaacctgctcgaaacgctgaccgtcgacctgatcgtgctggacatcatgatgcccggc
gacgacggcctggtgctgtgccgcgagctgcgcgccggcaagcaccgccgcaccccgatc
ctgctgctgaccgcgcgcgacgaggacatggatcgcgtgctggggctggagatgggcgcc
gacgactacctggtcaagcccttcgtggcgcgcgagctgctggcgcggatcaaggcgatc
ctgcgccgcacccgcatgctgccgcccaacttccaggtcaccgagcccggccgcgccgtg
cggttcggcgcctggacgctggacaccaccgcgcgccacctgctggatgccgaaggcacg
atcgtgtcgctgagcggcgccgaataccgattgctgcgggtcttcctggaccatccgcag
cgggtgctgaaccgcgaccagctgctgaacctgacgcaggggcgcgacgccgatttcttc
ggccgctcgatcgacctgctggtcagccgcctgcgccagcggctgcgcgaggacgcgcgc
gagccgatgtatatcaagacggtgcgcagcgaaggctatgtattcgccgcgcaggtcgac
gtgtccgaggccacgtag

DBGET integrated database retrieval system