KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_04693Help
Entry
ERS451415_04693   CDS       T04522                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase dacC precursor
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00550  Peptidoglycan biosynthesis
axx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ERS451415_04693 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:axx01002]
    ERS451415_04693 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:axx01011]
    ERS451415_04693 (dacC)
Enzymes [BR:axx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ERS451415_04693 (dacC)
Peptidases [BR:axx01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ERS451415_04693 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:axx01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ERS451415_04693 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: CKH99959
UniProt: A0A0D6IFI8
LinkDB All DBs
Position
1:complement(5151008..5152183)
Genome map
AA seq 391 aa AA seqDB search
MEVKPLMLMKKLAASLLVATACMSGALAQSMPQPDLSAKAWLLLDETSGQVIASHAATAR
IEPASLTKIMTAYVVFGAIHNKELSPDQKVVISTRAWKVPPGSSKMFLEPGSRVSVDQLL
RGLMIQSGNDAAIALAEAVSGSVEAFVARMNDTAVQLGLHGTHFASPHGLPDPGTYSTVS
DLSILATRFIRDYPQLYKTYDSAKTYTYNNITQPNRNRLLWLDPSVDGLKTGHTDAAGYC
IVATAHRPNGKEQRRLITVVVGTASDKLRTQESRELLEWGFQGFNTIKLYAKGQAVATPE
VWKGQADTLKAGFARDAYVTVPAGAKVEPVWTPQDPLVAPIPAQATVGSVRVMVDGKPAM
QFPVVALEPVAEAGLAGRAWDSIRLWWRGHS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaagccccttatgttgatgaagaagttggcggcgagcctgctcgttgcgacc
gcgtgtatgtccggcgccctggcgcaatcgatgccgcagccggacctgtccgccaaggcc
tggctgctgctcgatgagaccagcggccaggtgatcgcatcgcacgcggccactgcccgg
atcgagccggcgtccctgaccaagatcatgacggcatacgtggtgttcggcgcgatccac
aacaaggagttgtcgccggaccagaaagtggtgatctcgacgcgggcgtggaaagtgccg
ccgggcagttcgaagatgttcctggagccgggctccagggtctcggtcgaccaactgttg
cgcggcctgatgatccagtccggcaatgacgccgccatcgccttggccgaggcggtgtcg
ggcagcgtcgaggcgttcgtggcccgcatgaacgacaccgccgtgcaactgggcctgcat
ggcacgcatttcgccagcccgcacggcctgccggatccgggcacgtattcgaccgtcagc
gacctgtcgatcctggccacgcgcttcatccgcgactacccccagctgtacaagacctac
gattcggccaagacctatacctacaacaatatcacccagcccaaccgcaaccggctgctg
tggctcgatcccagcgtcgacggcctcaagacaggccacaccgacgcggccggatattgc
atcgtggccaccgcgcaccggcccaacggcaaggagcagcgccgcctgatcaccgtggtg
gtcggcacggcgtcggacaagctgcgcacccaggaaagccgcgagttgctggaatggggc
ttccaggggttcaataccatcaagttatatgcaaagggccaggccgtggccacgcccgag
gtctggaagggccaggccgatacgctcaaggccggcttcgcgcgcgacgcctacgtcacg
gtacccgcgggcgccaaggtcgaaccggtgtggacgccgcaggatccgctggtggcgccg
attccggcccaggccacggtgggttcggtgcgcgtcatggtcgacggcaagcccgcgatg
cagtttccggtggtggcgctggaaccggtggccgaggcgggcctggccggacgcgcctgg
gattccatccggctttggtggcgcgggcattcttga

DBGET integrated database retrieval system