KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_04945Help
Entry
ERS451415_04945   CDS       T04522                                 

Gene name
yfcG_5
Definition
(GenBank) GST-like protein yfcG
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:axx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ERS451415_04945 (yfcG_5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:axx02000]
    ERS451415_04945 (yfcG_5)
Enzymes [BR:axx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ERS451415_04945 (yfcG_5)
Transporters [BR:axx02000]
 Other Transporters
  Pores ion channels [TC:1]
   ERS451415_04945 (yfcG_5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: CKI06367
UniProt: A0A0D6IIL0
LinkDB All DBs
Position
1:complement(5421873..5422487)
Genome map
AA seq 204 aa AA seqDB search
MLTLYHAPRSRSFRILWLLEELGVPYDTEMVSIRRRDGSGHIPPDYIDIHPHGKVPALVH
DGVPVFETPAIALYLTDLFPQAGLGPVIGDPQRGPYLTWLAYSTGVFEPAMTERVFKTAH
QQGTMGWGSADEVEQVVTRVLQARPYFLGEHFSAVDIVLGGTLQFMMQMKVIAENPVFSA
YAERLAARPAMHRALQRDGDIGEG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccctctatcacgccccgcgctcgcgctctttccgcatcctctggctgctcgaa
gagctgggcgtgccctacgacaccgagatggtgtcgatccgccgccgcgacggctccggc
catatcccgcccgactacatcgacatccacccgcacggcaaggtgccggcgctggtgcac
gacggggtgccggtgttcgaaacccccgccatcgcgctttacctgaccgacctgttcccc
caggccggcctgggtccggtcatcggcgatccgcaacgcggtccctacctgacctggctg
gcctactcgaccggcgtgttcgagcccgccatgacggagcgcgtgttcaagacggcgcac
cagcagggcacgatggggtggggctcggccgacgaggtcgaacaggtcgtgacccgggtg
ctgcaggcccgcccgtatttcctcggcgagcatttcagcgccgtcgacatcgtgctgggc
ggcaccttgcagttcatgatgcagatgaaggtgattgccgagaacccggtgttctcggcc
tatgccgaacggctggcggcgcgtccggcgatgcaccgcgccttgcagcgcgacggtgac
atcggcgaaggctga

DBGET integrated database retrieval system