KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_05637Help
Entry
ERS451415_05637   CDS       T04522                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00620  Pyruvate metabolism
axx00680  Methane metabolism
axx01100  Metabolic pathways
axx01120  Microbial metabolism in diverse environments
axx01200  Carbon metabolism
Module
axx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:axx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERS451415_05637 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    ERS451415_05637 (ppc)
Enzymes [BR:axx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ERS451415_05637 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: CKI18667
UniProt: A0A0D6IPZ7
LinkDB All DBs
Position
1:6186823..6189669
Genome map
AA seq 948 aa AA seqDB search
MNASRPQSDSAEPLRHDIRLLGRLLGEVIAECEGKRVFDTIETLRRTAVKFRREGNAADG
KLLEQRVKHLQGSDPNSVARAFSYFLHLSNIAEDRDQNRSQRARALAGDAPARGSLHDAV
QTLGRQGVTPARIRRLLAEACVMPVLTAHPTEVQRKSTLDVHREIAAALTQRDQPLTPEE
LAELDAALLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRVYGDLSKLLNR
DAKPFGAPPAPLEPFLRMGSWIGGDRDGNPNVDADTLERALLRQATVLFEHYLQEVHALG
AELSITTLLIAVDPALLALAEHSGDDSPHRSDEPYRRALVGVYARLAATALRLTGQNLAR
RSTVAAQPYDTPQELSADLAIIAASLAAHHGAPIGRLRLAGLQQAVEVFGFHLATVDLRQ
SSDVHERALAELFSRAGVTHAGQPLDYLALDEDARVALLRAELAQARPLASPWIAYSEDT
TRELAVLRAAAAGRQRYGRQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGQDIPPED
GLMVVPLFETIPDLQRGADIMAAWLDLPEIRERVKRAQNGAQEVMLGYSDSNKDGGFLTS
NWSLYQAERALVDVFSSRHVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTEQ
GEVIQSKYKDAEVGRWHLELLVAATLESSLAPRAEATSAEDAHMAQHGPAMSFMSETAQR
SYRGLVYDTPRFAEYFFAATPIAEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCRL
MLTGWYGMGSAIEAYLETGAPGAPRSQRGRLAQLREMARDWPAFRTLLSNMEMVLAKSDL
AIAARYAQLVPQRALREKIFGMISAEHARTLAMLKLLTRRELLADNPALQASLRERFAYI
DPLNYLQVDLIRRHRAAQKSPAAEADERVQRAIHLTINGIAAGLRNSG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccagccgcccgcagtccgattcagcagaacccttgcgtcacgatatccggctg
ttaggccgattgctcggcgaagtcatcgccgaatgcgaaggcaaacgcgtcttcgacacc
atcgagaccctgcgccgcaccgccgtcaaattccgccgcgaaggcaatgccgccgacggc
aagctgctggaacagcgcgtcaagcacctgcagggcagcgaccccaactcggtggcgcgc
gccttcagctatttcctgcacctgtccaacatcgccgaggaccgcgaccagaaccgcagc
cagcgcgcccgcgcgctggcgggcgacgcgccggcccgcggcagcctgcacgatgccgtg
cagaccctgggccgccagggcgtgacgcccgcgcgcatccgccgcctgctggccgaggcc
tgcgtcatgccggtgctgaccgcccaccccaccgaggtgcagcgcaagagcacgctggac
gtgcatcgcgagatcgccgcggcattgacccagcgcgaccaacccctgactcccgaggaa
ctggccgagctcgacgccgcgctgctcggccgcgtggccacgctgtggcagacgcgcatg
ctgcgctacacccgcctgacggtggccgacgaaatcgagaacgcgctgtcgtactaccgc
agcaccttcctgcaggtcatcccgcgcgtctacggcgacctgtccaagctgctcaaccgc
gacgccaagcccttcggcgccccgcccgcgccgctggagccgttcctgcgcatgggcagc
tggatcggcggcgaccgcgacggcaaccccaacgtcgacgccgacacgctggagcgcgcc
ctgctgcgccaggccacggtgctgttcgagcactatctgcaggaagtccacgcgctgggc
gccgaactgtccatcaccacgctgctgatcgcggtcgacccggcgctgctggcgctggcc
gaacacagcggcgacgactcgccgcatcgcagcgacgagccctaccgccgcgcgctggtc
ggcgtctatgcgcgcctggccgccaccgcgctgcgcctgaccggccagaacctggcccgc
cgcagcaccgtcgcggcgcaaccctacgacacgccgcaggaattgtcggccgacttggcc
atcatcgccgcgtcgctggccgcgcatcatggcgcgcccatcggccggctgcggctggcc
ggcttgcagcaggcggtcgaagtgttcggtttccacctcgccacggtcgacctgcgccag
agttccgacgtgcacgagcgcgcgctggccgaattgttcagccgcgccggcgtcacgcac
gcgggccagccgctggactatctggcgctggacgaggacgcgcgcgtggccctgctgcgc
gccgaactggcgcaggcgcggccgctggcctcgccctggatcgcctacagcgaggacacc
acgcgcgaactcgcggtgctgcgcgccgccgccgccggccgccagcgctatggcaggcag
gccgtgcgccagaccatcgtctcgcacaccgaaaccctcagcgacctgctggaagtgatg
gtgctgcagaaggaagcgggcctgatcgcgcccgccggccaggacatcccgccggaagac
ggcctgatggtggtgccgctgttcgagaccattcccgacttgcagcgcggcgccgacatc
atggccgcctggctcgacctgcccgagatccgcgagcgcgtgaagcgcgcccagaacggc
gcccaggaagtcatgctgggttattccgacagcaacaaggacggcggtttcctcacctcc
aactggtcgctgtaccaggccgagcgcgcactggtcgacgtgttctccagccgccacgtg
cgcctgcgcctgttccatggacgcggcggctcggtgggccggggcggcggctccagcttc
gacgccatcctggcgcagccgccgggcacggtggccggccagatccgcctgaccgaacag
ggcgaggtcatccagagcaagtacaaggacgccgaggtcggccgctggcacctggagctg
ctggtcgccgccacgctcgaatccagcctggcgccgcgcgccgaggccaccagcgcggaa
gacgcgcacatggcgcagcacggcccggccatgtcgttcatgtccgagaccgcgcagcgc
agctaccgcggcctggtgtatgacacgccgcgctttgccgagtacttcttcgccgccacg
cccatcgccgagatcgccggcctgaacatcggctcgcgcccggcctcgcgcaagaagggc
cagcgcatcgaagacctgcgcgccatcccctgggggttttcctgggcccaatgccgcctg
atgctgaccggctggtacggcatgggctcggccatcgaggcctatctggagaccggcgcg
ccgggggcgccgcgctcgcagcgcggccgcctggcccagttgcgcgaaatggcgcgcgac
tggcccgccttccgcaccctgctgtccaacatggagatggtgctggccaagtccgacctg
gccatcgccgcgcgctatgcgcagttggtgccgcagcgcgcgctgcgcgagaagatcttc
ggcatgatcagcgccgaacacgcccgcaccctggccatgctcaagctgctgacgcggcgc
gagctgctggccgacaaccccgcgctgcaggcctcgctgcgcgagcgcttcgcctacatc
gacccgctcaactacctgcaggtcgacctgatccgccgccaccgcgcggcgcagaagtcg
cccgccgccgaggccgacgaacgcgtgcaacgcgccatccacctgaccatcaacggcatc
gccgccgggttgcgcaattcgggctga

DBGET integrated database retrieval system