KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_06128Help
Entry
ERS451415_06128   CDS       T04522                                 

Gene name
mdeA_5
Definition
(GenBank) Methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00270  Cysteine and methionine metabolism
axx00450  Selenocompound metabolism
axx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ERS451415_06128 (mdeA_5)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ERS451415_06128 (mdeA_5)
Enzymes [BR:axx01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     ERS451415_06128 (mdeA_5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 ATPgrasp_N
Motif
Other DBs
NCBI-ProteinID: CKI25687
UniProt: A0A0D6IW69
LinkDB All DBs
Position
1:6720861..6722042
Genome map
AA seq 393 aa AA seqDB search
MSPYSDSYTRLAQAAVSPPESSYPVAPPLYQTASFATDEASVFLDMATRPLHSGFYTRYG
NPTTRAFESAVADLEGGECALATASGMGAITAALFAFAARGDHVVAQRVLYGGTTGLLQN
IAPQLGIDVTFVDQADVAGFAAAVRPNTRLFMLESPSNPMLRLTDLARLAEIARARGITT
LADNTIASPINQRPLEFGIDLVMHSATKYLCGHGDVSAGVLVGDERRIKAVWEKAYLLGA
TLDPFAAWLVLRGLRTLPMRVARQNETALKVARYLEAHASVCAVHYPGLESHPQRALAQT
QMSGHGGVLSFEVAGGMAQAERVVGALALAHRSASFGSFSTLVVHPAAMWAGMMTPEQLA
ASGLPPGLIRLGVGFESPAAIIDDLDTALAAAD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctccctactccgactcctacacccgcttggcgcaggcggccgtttcgccgccggaa
agttcgtatcccgtggccccgccgctgtaccagacggccagcttcgccacggacgaggcc
agcgtcttcctcgacatggcgacgcggcccctgcattcgggattctatacacgctacggc
aacccgacgacccgcgcgttcgagtccgcggtggccgacctggaaggcggcgagtgcgcg
ctggcgaccgcctcgggcatgggcgccatcacagcggcgctcttcgcgttcgcggcgcgg
ggcgaccatgtggtcgcgcagcgcgtgctatacggtggcaccacaggactattgcagaac
atcgccccgcagctgggaatcgacgtgactttcgtggaccaggcggacgtggccgggttc
gcggcggccgtgcggcccaatacccgccttttcatgctggaaagcccgtccaatccaatg
ctgcgactgaccgacctggcgcggctggcggaaatcgcgcgggcacgcggcatcacgacg
ctggcggacaatacgatcgcgtcgcccatcaaccagcgcccccttgaattcggcatcgac
ctcgtcatgcacagcgccaccaaatacctgtgcggccacggcgacgtgtcggcaggcgtg
ctcgttggagacgagaggcgcatcaaggccgtctgggaaaaggcttacctgctcggcgcc
acgctggacccgttcgcggcctggctggtgctgcggggcctgcgtacgctgcccatgcgg
gtcgcgcgccagaatgaaacggcgctgaaggtggcgcggtacctggaagcacacgcgtcg
gtctgcgcggttcactaccccggcctggaaagccacccgcagcgggcgctggcacaaacg
cagatgagcggtcacggcggcgttctcagtttcgaggtggctggaggcatggctcaggcc
gagcgagtcgtgggcgcgcttgcgctggcccatcgttcggcaagcttcgggtcgttctcg
acgctggtggtgcatccggcggcgatgtgggccggcatgatgacaccggaacagttggcg
gcctccgggctgccgccaggtctgatccggctgggagtgggtttcgagagccctgccgca
atcatcgacgatctggataccgcgctcgcggcagccgactga

DBGET integrated database retrieval system