KEGG   Achromobacter xylosoxidans A8: AXYL_00167Help
Entry
AXYL_00167        CDS       T01341                                 

Definition
(GenBank) stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
axy  Achromobacter xylosoxidans A8
Brite
KEGG Orthology (KO) [BR:axy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:axy03021]
    AXYL_00167
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:axy02000]
    AXYL_00167
Transcription machinery [BR:axy03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     AXYL_00167
Transporters [BR:axy02000]
 Other Transporters
  Pores ion channels [TC:1]
   AXYL_00167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: ADP13527
UniProt: E3HPE8
LinkDB All DBs
Position
complement(176276..176887)
Genome map
AA seq 203 aa AA seqDB search
MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDISVMNPYGQVPILVERDLVL
YESNIINEYIDERFPHPQLMPADPVMRARTRLFLYNFEKELFVHVSTLEDRSAKPDEKKL
ANARQNIRDRLAQLAPMLLKNKYMLGEEFSMLDVAVAPLLWRLDHYGIELPKNAAPLQKY
AERIFSRPAYIEALTPSEKVMRR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgctctattccggaaccacgtgtccgttttcgcaacgctgccgcttcgtgttg
ttcgagaaaggcatggatttcgagatccgcgacatcgacctgtacaacaagcccgaagac
atctcggtgatgaacccgtacggtcaagtgcccattctggtcgaacgcgacctggtcctg
tacgagtcgaacatcatcaacgagtacatcgacgagcgcttcccgcatccgcagctgatg
cccgccgacccggtcatgcgcgcccgcacccgcctgttcctctacaacttcgagaaggaa
ctgttcgttcacgtctcgacgctggaagaccgcagcgccaagcccgacgaaaagaagctg
gccaacgcccgccagaacatccgcgaccgcctggcccagctggcccccatgctgctgaag
aacaagtacatgctgggcgaggaattctccatgctcgacgtggccgtggctccgctgctg
tggcgcctggaccactacggcatcgaactgcccaagaacgcggcgccgctgcaaaagtac
gccgaacgcatcttctcgcgtccggcctacatcgaagcgctgacgccttcggaaaaagtg
atgcgtcgctaa

DBGET integrated database retrieval system