KEGG   Achromobacter xylosoxidans A8: AXYL_01631Help
Entry
AXYL_01631        CDS       T01341                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00020  Citrate cycle (TCA cycle)
axy00190  Oxidative phosphorylation
axy00650  Butanoate metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
Module
axy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
axy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
axy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AXYL_01631 (sdhA)
   00650 Butanoate metabolism
    AXYL_01631 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AXYL_01631 (sdhA)
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AXYL_01631 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AXYL_01631 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like GIDA Thi4 FAD_binding_3 Lycopene_cycl Pyr_redox_3 FAD_oxidored NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADP14969
UniProt: E3HUK6
LinkDB All DBs
Position
1726849..1728627
Genome map
AA seq 592 aa AA seqDB search
MVSVMKSLPRRQFDVVVVGAGGAGMRCSLQLAQAGLSVAVLSKVFPTRSHTVAAQGGVSA
SLGNMSEDNWYWHMYDTVKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNPDGTIY
QRPFGGHTANFGEKPVQRACAAADRTGHALLHTLYQRNVAARTQFFVEWMALDLLRNEAG
DVVGVTALEMETGEIYILEAKTTVLATGGAGRIWAASTNAFINTGDGLGMAARAGIPLQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILLNKDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPDGSYVVLKLDHLGADVINKRLPSIREIAIKFGNVDPIKEPIPVVPTIHYQ
MGGIPANYHGQVLSRENGENKVVNGLYAIGECAAVSVHGANRLGTNSLLDLIVFGRATGN
HIVNSHPERQHAHQPVPQQAVEFSLDRVNKLESRTSGEKTQDIGNAIRFSMQRHCGVFRT
LELLNEGVTQIEDLAKQADNIYFKDKSKVFNTARVEALEMANMTEVARATIKSAAARTES
RGAHALDDHPTRDDENWLKHTLWYSEGSRLDYKPVQMKPLTVESFPPKARTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggtctctgtcatgaaatccctgccgcgccgccagtttgatgtggtggtcgttggcgcc
ggcggagccggcatgcgttgttcgctgcaattggcccaggcgggcctgtccgttgcagtg
ctgtccaaggtgttccccacgcgttcgcacaccgttgccgcgcaaggcggcgtgagcgct
tcgctgggcaacatgagcgaagacaactggtactggcacatgtacgacaccgtcaagggt
tcggactggctgggcgaccaggacgccatcgaattcatgtgccgcgaagcgccgaacgcc
gtgtacgagctcgaacacttcggcatgccgttcgaccgcaaccccgacggcaccatctac
cagcgtccgttcggcggccacaccgccaacttcggtgaaaagccggtccagcgcgcctgt
gccgctgccgaccgcaccggccacgcgctgctgcacaccctataccagcgcaacgtcgcc
gcgcgcacccagttcttcgtcgaatggatggcgctggacctgctgcgcaacgaagcgggc
gacgtcgtgggcgtgaccgccctcgaaatggaaacgggcgaaatctacatcctggaagcc
aagaccacggtgctggccaccggcggcgccggccgcatctgggccgcttccaccaacgcc
ttcatcaacaccggtgacggcctgggcatggccgcccgcgcgggcatcccgctgcaggac
atggaattctggcaattccacccgaccggcgtggccggcgccggcgtgctgatcacggaa
ggcgtgcgcggcgaaggcggcatcctgctgaacaaggatggcgaacgcttcatggagcgc
tatgcgcccacgctgaaggacctggctccgcgtgacttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggtcgcggctgcggtccggacggcagctacgtggtcctcaagctggat
cacctgggcgccgacgtcatcaacaagcgcctgccctcgatccgcgaaatcgccatcaag
ttcggcaacgtggacccgatcaaggaaccgatccccgtcgttcctaccatccactaccag
atgggcggcattccggccaactaccacggccaggtgttgtcgcgcgaaaatggcgaaaac
aaggtcgtcaacggcctgtacgccatcggcgaatgcgccgcggtgtcggtgcacggcgcc
aaccgcctgggcaccaactcgctgctggacctgatcgtgttcggccgcgccaccggcaac
cacatcgtcaattcgcatccggaacgccagcacgcgcaccagcccgtgccgcagcaagcc
gtcgaattctcgctggaccgcgtcaacaagctggaatcgcgcacctcgggcgaaaagacc
caggacatcggcaatgccatccgcttctcgatgcagcgccactgcggcgtgttccgcacg
ctggaactgctgaacgaaggcgtgacccagatcgaagatctggccaagcaagccgacaat
atctacttcaaggacaagtccaaggtgttcaacaccgcgcgcgtcgaggcgctggaaatg
gcgaacatgacggaagtggcccgcgccaccatcaagtcggccgccgcccgcaccgaaagc
cgcggcgcgcacgcgctggacgaccacccgacgcgcgacgacgaaaactggctgaagcac
acgctgtggtactccgaaggcagccgcctggattacaagcccgtgcagatgaagccgctg
acggtcgagtccttcccgcccaaggcgcgtaccttctaa

DBGET integrated database retrieval system