KEGG   Achromobacter xylosoxidans A8: AXYL_01632Help
Entry
AXYL_01632        CDS       T01341                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00020  Citrate cycle (TCA cycle)
axy00190  Oxidative phosphorylation
axy00650  Butanoate metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
Module
axy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
axy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
axy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AXYL_01632
   00650 Butanoate metabolism
    AXYL_01632
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AXYL_01632
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AXYL_01632
    1.3.5.4  fumarate reductase (quinol)
     AXYL_01632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-ProteinID: ADP14970
UniProt: E3HUK7
LinkDB All DBs
Position
1728646..1729362
Genome map
AA seq 238 aa AA seqDB search
MSNKRIVKFEIYRYDPDKDERPYMQKLEVELQPTDKMLLDALVRIKNDVDDSLALRRSCR
EGVCGSDAMNINGKNGLACTTNLRELKEPIVLRPLPGLPVIRDLIVDMTHFFNQYHSIRP
YLINDTPPPEKERLQSPEAREELDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYR
FIADSRDEATGSRLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaagagaatcgtcaagttcgaaatctaccgctacgatccggacaaggacgag
cgcccgtacatgcagaagctggaagtcgaactccagccgaccgacaagatgctgctcgat
gcgctggtgcgcatcaagaacgacgtcgatgacagcctggccctgcgccgctcgtgccgt
gaaggcgtgtgcggttcggacgccatgaacatcaacggcaagaacggtctggcgtgcacc
accaacctgcgcgaactgaaggaacccatcgttctgcgtccgctgccgggcctgcccgtc
atccgcgacctgatcgtggacatgacgcacttcttcaaccagtaccactcgatccgcccg
tacctcatcaacgacacgccgccgcccgaaaaagagcgtctgcagtcgcccgaggcgcgc
gaagagctggatggcctgtacgagtgcattctgtgcgcgtgctgttccacttcctgcccg
tcgttctggtggaacccggacaagttcgtcggcccggccggcctgctgcaagcctaccgc
ttcatcgccgacagccgcgacgaagccacgggcagccgtctggacaacctggaagatccg
taccgcctgttccgttgccacaccatcatgaattgcgtcgacgtctgtcccaagggactg
aacccgaccaaggcgatcggcaagatcaaggaactgatggttcgccgcacggtctag

DBGET integrated database retrieval system