KEGG   Achromobacter xylosoxidans A8: AXYL_02596Help
Entry
AXYL_02596        CDS       T01341                                 

Definition
(GenBank) amino acid adenylation domain protein 2
Organism
axy  Achromobacter xylosoxidans A8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ADP15916
UniProt: E3HPT2
LinkDB All DBs
Position
2754894..2760155
Genome map
AA seq 1753 aa AA seqDB search
MTNSPVPQEKFVHPENFVDGLRQLAADRPEDVALTVVAGREGEIVETVLTYRAFAQRVLA
LAALLQARYEKGDRILILLDNDEYYAVSMFACFHAGVIAVPAFPPESARPQHLARLAGIV
EDSQARGVLTTGALRALVGEAARQFDMLDIVAVDEVDPAEASRWQPQRPDGADVAFLQYT
SGSTSAPKGVMVTHANLMANERAIREGLSIGAGDKFGVWSPLFHDMGLIGGLLQPFYSGI
PCVLSSPRFFLERPVRWLEMISRHRITISGGPDFAYRLCLDRVKDANCEGLDLSSWRVAY
TGAEPVRQDTMEAFVERFAPMGFSAGAVYPCYGLAEATLFVTGGRRGSGMAVGRYDNEAL
SKRLAVAQADGAALVGCGSAAPGHELRIVDTQSGEPAAQGAIGEIWAAGPSVAAGYWNNP
SDSAETFVERDGHRWLRTGDLGFVDGGELFVAGRHKDMIIVRGHNLYPQDIERVVEEEVE
AVRKGRVAAFAVELDGQEGIGVAAEVSRGLQKLVPPQALVDALGAAVSGQCGEAPRVVVL
LQPGALPKTSSGKLQRTACRKGWAERTLDAYALYESGRFLMGGDIGEAAVDGRNALPEDQ
IQPLANVWRDVLGHETARRYSSDAHFFTLGGNSLAAMQLAARISQTWETDFPVRQVFESP
RLGEQAAALQTCLQIGSRKPFAGIPVLSAECRSKPLPLSSAQQRQWFLWRLTPHSTAYHV
QGALRIAGLLDVDALRAAVAGLITRHETLRTIFRARPDGEAEQMVLPGGTLELQVVDLRT
VTSAERDAQAAQTLRAFLAPPFDLTAGPLARAALMRLDDQVHVLALAMHHIISDGASMQV
LVDDLAALYAADEALPACSIQYADYASWQRDDAVRDAQDRQLAYWVEQLAMPSGESQPGL
ALPADHPRLPVAQYRAGLHTFELPAELLAALRCQAEVHGATLFMALLASLQALLHRHTGQ
RDVRVGVPVANRPRAELQGVVGIFVNTVVLQSDIEMRQSLAQVLAQVRERVLGAQANQEA
PFEQVVEALRPARSAGTALLFDVMFNHSRRDYSQLQQRSGWRVTEEPTGNEHAQFELAVD
TVEDVDGRLVVTFRYAVELFDAATIARMAGHYVAMLGALADAPEQAVGDVKLLSDAEGRK
LRAWGESPLRSSRIEPVHRQIEQHVRAHPRTVALWFGEESVSYEELNRRSNRLAHRLIGL
GVKPETRVGIAMERSIEMVAGLLAILKAGGAYVPLDPELPAERLEYMLEDSGIELLLTQS
GIRGRLPADKRLQVLEVDALDLGGEREHDPGVAVHGENLAYVIYTSGSTGRPKGAAIRHR
SLAICMSWMQQTYGLTAEDVVLHKAPFGFDVSVWEIFWPLTTGVRLVVAAPGDHREPERI
TALIRRHQITTLNFVPAMLQAFLAHEGIETQTRLRYVMCGGEAMSAAMQSEALRRLRGVS
LQNLYGPTETTIHVTQWKCRDDGQGRVPIGRPIAQTKSYVLDASLNLVPQGVEGELYIGG
DLLGRGYLGRPGLSAERFVADPFDETGGRLYRTGDLARWNGEGQLEFLGRTDHQVKIRGL
RIELGEVEAQLLALPEIREAVVVDKGARLVAYVSLAAEKMLDVRELRARLARVLPDYMVP
GVIVSMESLPLNANGKVDRRALPEPETPSFPIFEEPAGEVEAVLAQLWNEALGVESVDRN
DNFFELGGHSLIAVRMAAILANRYAFEVPVRMFFEAPILRDFALRLSEQGTPDAGSRQDR
LALMHNLMSEFEV
NT seq 5262 nt NT seq  +upstreamnt  +downstreamnt
atgacgaattcgcctgtgccgcaagagaaatttgttcatcccgagaattttgtcgacggc
ctgcgccagctggctgcagaccggcccgaggacgtcgcgctgacggtggtcgcgggtcgg
gaaggcgaaatcgtcgaaacggtcttgacctatcgcgccttcgcgcagcgcgtgctggcg
cttgccgccttgctgcaagcgcgctacgagaagggcgaccggatactgatcctgctcgac
aacgatgaatactatgcagtcagcatgtttgcctgcttccatgccggtgtgattgcagtg
ccggcgtttccgcccgaatccgcgcggccgcagcacctggcccggcttgcggggatcgtg
gaggactctcaggcgcggggtgtgctgacgacaggcgcgttacgcgcgttggtcggggag
gcggcgcgccagttcgacatgttggatatcgtggccgtcgacgaggtcgatccagccgag
gccagccgctggcagccgcaaaggccggacggcgccgacgtcgccttcctgcagtacacc
tcggggtccacttcagcacccaagggcgtgatggtgacgcacgccaacctgatggccaat
gagcgcgccatccgcgaaggactctcgatcggcgccggcgacaaattcggcgtgtggtcg
cccttgttccacgacatgggcctgatcggcggactgctgcagcctttctacagcggcatc
ccctgcgtgctgtcctcgccgcgcttcttcctggagcgccccgtgcgttggctcgagatg
atctcgcgccatcggataacgatcagcggggggccggactttgcataccggctgtgcctg
gaccgggtcaaggatgccaactgcgagggattggacctgtcgagttggcgcgtggcctac
accggcgccgagccggtgcggcaagacacgatggaagcgttcgtcgaacgtttcgcgccc
atgggcttcagcgccggcgccgtttacccctgctatggtctggccgaggcgacgctgttc
gtcacgggagggcgccgcggaagcggcatggcggtgggccgctatgacaatgaagcgctc
tcaaagcggctcgcggtcgcccaggccgatggtgcggcattggtcggctgcggcagcgcc
gccccggggcacgagttgcgtattgtcgatacgcagtccggcgagcccgccgctcagggc
gccatcggcgagatctgggctgccggccccagcgtggcggcaggatattggaacaacccg
agcgatagcgccgagaccttcgtcgaacgtgatggccatagatggctgcgcaccggggac
ctgggcttcgtagacggcggcgaacttttcgtcgcgggccggcacaaggacatgatcatc
gtccgcggacacaatctgtatccgcaggacatcgaacgagtggtggaagaggaggtggag
gccgtacgcaaaggccgggtagcggcctttgctgtggaactcgacggacaggaaggtata
ggcgtcgcggccgaggtgtcgcgcggtttgcagaagctcgtgccgccgcaggctctggtc
gatgcgctgggcgcagcggtgagcgggcaatgcggcgaggcaccgagagtggttgtgttg
ttacagccaggcgcgttgcccaagacttccagcggtaagctgcaacgcaccgcttgccgc
aaaggatgggccgagcgcacgctcgatgcctacgcgctgtacgagagcgggcgcttcttg
atgggcggggacattggcgaggcggctgtggatggcagaaatgccctcccggaagatcag
atccagccgttggcgaacgtttggcgcgacgttctcgggcacgaaacggcacggcggtac
agcagcgacgcgcacttcttcacgctgggtgggaattccctggcggcgatgcagttggct
gcacgcatctcgcaaacttgggaaaccgacttcccggtccggcaggttttcgaatcgccg
cggttgggcgaacaggctgcggccttgcagacctgcctgcaaatcgggtcgcgcaagcct
tttgccggcatccccgtgctgtctgcggaatgccgctccaagcctctgcctctgtcgtct
gcccagcagcggcaatggttcctgtggcggctgaccccccacagcaccgcatatcatgtt
cagggcgcgctgcgtattgcgggcttgctggatgtcgatgccttgcgtgcggccgtagct
ggtttgatcacgcgtcacgagacgttgcgcaccatattccgcgcgcggccggatggcgag
gcggagcagatggtgcttcctgggggaaccctggagctccaggtagtcgacctgcgcacc
gtgacgagcgcggagcgcgacgcgcaggctgcgcaaacgctgcgcgcattcctggcgccg
cccttcgacttgacggccggccccttggcgcgggcagcgctgatgcgactggacgatcag
gtccatgtactggcgctggcgatgcaccacatcatttcggatggcgcttcgatgcaggtc
ttggtcgacgacctggctgcgttgtacgcggcagacgaggcgctgcccgcctgctcaatt
caatatgctgactatgccagttggcagcgcgacgatgccgtgcgggacgctcaggatcgc
cagttggcgtattgggtggagcagctcgccatgccctcgggcgagtcacagcccggcctg
gctctgcctgccgatcatccccgcctgccggttgcccaatatcgggcaggattgcacacc
ttcgaactcccggccgagctgctggctgccctgcgctgccaggccgaagtccatggcgcc
actctgttcatggcgttgttggcctccttgcaggcgctgttgcaccgccataccgggcaa
cgggacgtccgcgtcggtgtgcctgttgccaaccgcccgcgagcggagctgcagggcgtg
gtgggtattttcgtcaatacggtggtattgcagagcgatatcgagatgcgtcagagcctg
gcgcaggtgctggcacaggtccgggagcgcgtgctgggcgcgcaggcaaatcaggaagcg
ccattcgagcaggtcgtcgaggcgttgcggccggcgcggagcgcaggcaccgcgctgctt
tttgacgtgatgttcaaccattcgcggcgggactactcgcaacttcaacagcggtcgggc
tggcgagtgactgaagagcccacggggaatgagcatgcgcaattcgagttggccgtagac
acggtcgaagatgttgacggacgcctggttgtgaccttccgctatgcggtggagctgttc
gatgccgcgaccatcgcccggatggcggggcattatgtggcgatgctcggggcgctggct
gacgcgccagagcaggcggtgggcgatgtgaagctgttgagcgacgcggagggacgcaag
ctcagggcctggggtgagagtccactacgatcttccaggattgagccggttcaccggcag
atcgagcaacacgtgcgcgctcatccgcggaccgtggccttgtggttcggcgaggagagc
gtgagctatgaggagctcaaccgccgctccaaccgtctggcgcacaggctgatcggcctg
ggtgtcaagccggagacgagagtaggcattgccatggagcgctccatcgagatggtggcg
gggttgctggcgatcttgaaggcgggaggcgcctacgttccgctggacccggagctcccg
gccgagcggctggagtacatgttggaggacagcggtatcgagctgctgcttacgcagagc
gggatccgtggccggctacccgccgacaagaggctgcaggtgctggaggtcgatgcgctc
gatctcggcggcgagcgggaacacgaccccggcgtggccgtgcacggagagaatctggcg
tacgtgatctatacctcgggttccacgggcaggcccaagggagcggcgatccgccatcgg
tcgctggcgatctgcatgagctggatgcagcagacctatggcctgaccgccgaggatgtc
gtgctgcacaaggcgccgttcgggttcgacgtgtctgtctgggagatattctggccgctg
acgactggcgttcggttggtggtggccgcgccgggtgaccaccgtgagcccgagcggata
acggcactgattcgtcggcaccagatcacgacactgaacttcgtaccggcgatgctgcag
gcctttctggcgcatgaaggcatcgagacgcagacgcggctgcggtacgtgatgtgtggc
ggcgaggccatgtccgcggccatgcagagcgaggcgctgcgccggctcaggggtgtgagc
ctgcagaacttgtacggcccgacagagacgaccatccacgtgacccagtggaagtgccgg
gacgacgggcaaggtcgggtgccgatcggaaggccgatcgcccaaaccaaatcctacgta
ctggatgcgtcgctgaatctggtaccgcaaggggtagagggcgagttgtacatcggtggc
gatctgctaggccgcggctatctgggtcgaccgggtttgagtgcggagcgcttcgtggcg
gacccgttcgacgaaaccggcggccggctgtatcgcacgggggacctggcgcggtggaac
ggggaggggcagctggagttcctgggccggacggatcatcaggtgaagatccgcggcttg
cggatcgagctgggggaggtggaggcgcagttgctggccctgcctgagattcgcgaggcg
gtagtggtagacaagggtgcccgactggtcgcctacgtgtcactggcggcggaaaagatg
ctcgatgtgcgcgaactgcgcgctcggcttgcccgggtgctgccggactacatggtgcct
ggagtgatcgtttcaatggaatccttgcccctcaacgccaacggcaaggtggatcgccgc
gccttgccggaacccgaaacgccgtccttcccgatattcgaggagcctgcgggtgaggtg
gaggcagtgctggcgcagctctggaacgaggcgctcggagtcgagtctgtcgaccgcaat
gacaacttcttcgagctgggcgggcattcgctcattgcggtccggatggcggcgattctg
gcgaatcgttatgcattcgaggtcccagtgcgcatgttcttcgaagccccgatcctgcgg
gactttgcgttgcgcctttcggagcaagggacgcccgatgcaggttcgcggcaggaccga
cttgcgctgatgcacaacctgatgagcgaattcgaggtttga

DBGET integrated database retrieval system