KEGG   Achromobacter xylosoxidans A8: AXYL_02812Help
Entry
AXYL_02812        CDS       T01341                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00061  Fatty acid biosynthesis
axy00780  Biotin metabolism
axy01100  Metabolic pathways
axy01212  Fatty acid metabolism
Module
axy_M00083  Fatty acid biosynthesis, elongation
axy_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AXYL_02812 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AXYL_02812 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:axy01004]
    AXYL_02812 (fabZ)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AXYL_02812 (fabZ)
Lipid biosynthesis proteins [BR:axy01004]
 Fatty acid synthase
  Component type
   AXYL_02812 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_3 PS-DH
Motif
Other DBs
NCBI-ProteinID: ADP16132
UniProt: E3HTL6
LinkDB All DBs
Position
3010308..3010763
Genome map
AA seq 151 aa AA seqDB search
MELDIKGIMERLPHRYPMLLIDRVVEMVPGKSIVAIKNVSINEPFFNGHFPHHPVMPGVL
IVEAMAQASALFSFTDENGGLKCEGSKTAYYLVGIDGARFRRPVVPGDQLRIEVEAERLS
RSICKYQARATVDGQEVASAKLMCAIRSLEE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgacatcaaggggatcatggagagactgccgcatcgttatccgatgctgctg
attgaccgcgtcgtcgaaatggtgcccggcaagtccatcgtggccatcaagaacgtctcg
atcaatgaaccgtttttcaacggccatttcccgcaccacccggtgatgccgggcgtgctc
atcgtggaagccatggctcaggcctccgccctgttctcgtttacggacgagaacggcggc
ctgaagtgcgaaggttccaagaccgcgtattacctggtcggcatcgacggcgcgcgtttc
cgccgtcccgtggtgccgggcgaccagttgcgcatcgaggtggaagccgaacgcctgagc
cgcagcatctgtaagtaccaagcgcgcgcgacggtggacggccaggaagtcgcctcggcc
aagctgatgtgcgcgattcgcagcctggaagagtaa

DBGET integrated database retrieval system