KEGG   Achromobacter xylosoxidans A8: AXYL_03174Help
Entry
AXYL_03174        CDS       T01341                                 

Definition
(GenBank) glutathione S-transferase, C-terminal domain protein 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AXYL_03174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:axy02000]
    AXYL_03174
Enzymes [BR:axy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AXYL_03174
Transporters [BR:axy02000]
 Other Transporters
  Pores ion channels [TC:1]
   AXYL_03174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: ADP16494
UniProt: E3HET5
LinkDB All DBs
Position
3410899..3411528
Genome map
AA seq 209 aa AA seqDB search
MSRWTFYSAPGTCALATHIALREAGADFDLVKLDMGALQQQSPEYLRVNPKGRVPALATE
HGVLTETPALLAFVAQSFPAAQLAPVDDPFAFARMQELASYLASTAHVAHAHKRRGARWA
DDPAAHAAMQAKVPQSMTACAAYLESQIVGPWAAGEHYSVVDGYLYTIGSWLEGDGVDLT
QFPKLTAYLARVAARPAVQRALAEAQAAA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttggactttttattccgcccctggcacctgtgcgctggcgacgcatatcgcg
ctgcgcgaagctggcgccgatttcgatctggtcaagcttgatatgggcgccctgcagcag
caaagccctgagtacctgcgcgtcaatcccaagggccgcgtgccggcgctggcgaccgaa
cacggcgtgctgaccgagacccccgccctgctcgccttcgtggcgcagagctttccggcc
gcgcagctggcgccggtcgacgatccgttcgcattcgcgcgcatgcaggaattagcgagc
tatctggcgtccaccgcccacgtggcgcacgcgcacaagcgccgcggcgcgcgctgggcg
gacgatccggccgcgcatgccgccatgcaggccaaggtgccgcaatccatgaccgcctgc
gccgcctatctcgaatcgcaaatcgtcggcccctgggcggcgggcgaacattacagcgtg
gtcgacggctatctgtacaccataggcagctggctggagggcgacggcgtggacctgacg
cagtttcccaagctgacggcctatctggcccgggtcgccgcccggccggccgtgcagcga
gcgctggccgaagcgcaggccgccgcctga

DBGET integrated database retrieval system