KEGG   Achromobacter xylosoxidans A8: AXYL_05113Help
Entry
AXYL_05113        CDS       T01341                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH] 2
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00061  Fatty acid biosynthesis
axy00780  Biotin metabolism
axy01100  Metabolic pathways
axy01130  Biosynthesis of antibiotics
axy01212  Fatty acid metabolism
Module
axy_M00083  Fatty acid biosynthesis, elongation
axy_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AXYL_05113
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AXYL_05113
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AXYL_05113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:axy01004]
    AXYL_05113
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AXYL_05113
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AXYL_05113
Lipid biosynthesis proteins [BR:axy01004]
 Fatty acid synthase
  Component type
   AXYL_05113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ADP18419
UniProt: E3HQB6
LinkDB All DBs
Position
5478907..5479680
Genome map
AA seq 257 aa AA seqDB search
MSAALPLAGKRGLVTGIANADSIAWGCAKAFRALGAELAVTYLNDKALRHVEPLARQVDA
PLLLPLDLTRAGQLEAVFDSVAAEWGQLDFVLHSIAFAPRDDLHGRVTDCSREGFLQAMD
LSCWSFIRMAKLAEPLMRKGGALFCMSYYGSQMVVEHYNMMGPVKAALESATRYLAAELG
PQGIRVHAISPGPLKTRAASGIAEFDTLLDRAQSKAPARSLVSIDDVGEATAWLATDAAR
RMTGQTIYIDGGYHIID
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcactgccgctggccggcaagcgcggcctggtgaccggcatcgccaacgcg
gactcgatcgcctggggctgcgccaaggccttccgcgccctgggcgcggagctggccgtg
acctacctgaacgacaaggcgctgcgccacgtggagccgctggcccgccaggtggacgcg
ccgctgctgctgccgctggacctgacgcgcgcaggccaactcgaggctgtcttcgacagc
gtggccgccgaatggggccagctggatttcgtgctgcactccatcgccttcgcgccgcgc
gacgatctgcacggccgcgtgaccgactgctcgcgcgagggcttcctgcaggccatggac
ctgtcctgctggtccttcatccgcatggccaagctggccgagccgctgatgcgcaagggc
ggcgcgctgttctgcatgagctactacggttcgcagatggtggtcgagcactacaacatg
atggggccggtgaaggccgcgctggaatccgccacccgctacctggcggcggaactgggt
ccgcagggcatacgcgtgcacgcgatatcgccgggaccgttgaagacgcgcgccgcctcg
ggcatcgccgaattcgacacgctgctggaccgcgcccagtccaaggcgcccgcgcgcagc
ctggtgtccatcgacgacgtgggcgaagccaccgcctggctcgccaccgacgccgcccgc
cgcatgaccgggcagacgatatacatcgacggcggttatcacatcatcgactag

DBGET integrated database retrieval system