KEGG   Achromobacter xylosoxidans A8: AXYL_05117Help
Entry
AXYL_05117        CDS       T01341                                 

Gene name
tkt2
Definition
(GenBank) transketolase 2
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00030  Pentose phosphate pathway
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
axy01230  Biosynthesis of amino acids
Module
axy_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AXYL_05117 (tkt2)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    AXYL_05117 (tkt2)
Enzymes [BR:axy01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     AXYL_05117 (tkt2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C BMC
Motif
Other DBs
NCBI-ProteinID: ADP18423
UniProt: E3HRE5
LinkDB All DBs
Position
complement(5483845..5485881)
Genome map
AA seq 678 aa AA seqDB search
MSNPTAPKLALADAIRALAMDAVQQANSGHPGAPMGMAEIAQALWAGNLRHNPKDPAWAN
RDRFVLSNGHGSMLIYALLHLTGYDLPIEELKNFRQLHSKTPGHPEVGITPGVETTTGPL
GQGLGNAVGMALAEALLAAEFNKPGHTLVDHHTYAFTGDGCLMEGISHEVCSLAGTLKLG
KLVVLYDDNGISIDGHVEHWFADDTAKRFEGYGWNVIRGVDGHDVAAVDAAIKAARKQSE
KPTLIVCRTVIGKGSPNMAGTHNVHGAPLGKDEIAATRAALGWSSEPFQIPQDIYDGWDG
RKQGAAAQAEWQSAFDAYAAEFPAEAAEFTRRMKGEMPAGYAEQFKAFLDATLEKAETVA
TRKASQFAITALAPLLPEMLGGSADLTGSNFTDWKGVAAVRAGDKGIQFGRHINYGVREF
GMAAIMNGVALHGGYLPFGGTFLTFSDYSRNAIRMAALMKQRVVHVFTHDSIGLGEDGPT
HQSIEHASSLRLIPNLSLWRPCDTAETAVAWNAAVTRPTSIGMDVHDGGPTALLLSRQNL
PFVPRDAATVEAIARGGYVLRDAEGARAVIIATGSEVAIALDAQAQLAKEGIAVRVVSMP
STDVFDRQDAAWKQSVLPKGLPRVAVEAGITAFWHKYVGLEGAVVGIDRYGESAPAGALF
KFFGLTADKVAETVKQVL
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatccgaccgcccctaaacttgccttggcggatgccatccgcgccctcgcgatg
gacgccgtgcaacaagcgaactccgggcatccgggtgctcccatgggcatggcggaaatc
gcccaggccttgtgggccggcaacctgcgtcacaatcccaaggatcccgcctgggccaac
cgcgaccgcttcgtgctgtccaacggccacggctcgatgctgatctacgccttgctgcac
ctgaccggctacgacctgccgatcgaagaactgaagaatttccgccagctgcattccaag
acgccgggccaccccgaagtgggcatcaccccgggcgtggaaacgaccaccggcccgctg
ggccagggcctgggcaatgccgtgggcatggcgctggccgaagcgctgctggccgccgag
ttcaacaagcccggccacacgctggtcgaccatcacacctacgccttcaccggcgacggc
tgcctgatggaaggcatctcgcatgaagtctgctcgctggccggcacgctcaagctgggc
aagctggtggtgctgtatgacgacaacggcatttccatcgatggccacgtcgagcactgg
ttcgccgacgacaccgccaagcgcttcgaaggctacggctggaacgtgatccgtggcgtg
gacggccatgacgtcgccgccgtggacgccgccatcaaggctgcgcgcaagcaatcggaa
aagcccacgctgatcgtctgccgcaccgtcatcggcaagggttcgcccaatatggccggt
acgcacaatgtgcacggcgcgccgctgggcaaggacgaaatcgccgccacgcgcgccgcg
ctgggctggtcgtcggagccgttccagattccgcaagacatttacgatggctgggatggc
cgcaagcagggcgccgccgcccaggctgaatggcagtcggcatttgacgcctatgccgcc
gaattccccgccgaagccgccgaattcacgcgccgcatgaagggcgaaatgcccgccggc
tatgccgaacagttcaaggcgttcctggacgccacgctggaaaaggctgaaaccgtcgcc
acccgcaaggcttcgcagttcgccatcaccgcgctggcgccgctgctgccggaaatgctg
ggtggctcggccgacctgacgggctccaacttcaccgactggaagggcgttgccgccgtc
cgcgccggcgacaagggcatccagttcggccgccacatcaactacggcgtgcgcgaattc
ggcatggccgccatcatgaacggcgtggccctgcacggcggctacctgccgttcggcggc
accttcctgacgttctccgactactcgcgcaacgccatccgcatggctgcgctgatgaag
cagcgtgtggtgcacgtgttcacccacgactccatcggcctgggcgaagatggtccgacc
catcagtcgatcgaacacgcctccagcctgcgcctgattcccaacctgtcgctgtggcgt
ccttgcgatacggccgaaaccgccgtggcctggaacgcggccgtgacgcgcccgaccagc
atcggcatggacgtgcatgacggcggcccgaccgccctgttgctgtcgcgccagaacctg
ccgttcgtgccgcgcgacgccgccaccgtcgaggccatcgcccgcggcggctatgtgctg
cgcgacgccgaaggcgcccgcgccgtcatcatcgccaccggctcggaagtcgccatcgca
ctggatgcgcaggcgcagctggccaaggaaggcatcgccgtgcgcgtggtctccatgccc
agcaccgacgtgttcgaccgccaggacgccgcctggaagcaatccgtgctgcccaagggc
ctgccgcgggtggccgtcgaagccggcatcaccgccttctggcacaagtacgtgggcctg
gaaggcgccgtcgtcggcatcgaccgctacggtgaatccgcgcctgccggtgcactgttc
aagttcttcgggctgaccgccgacaaggtggccgagaccgtcaagcaagttttgtaa

DBGET integrated database retrieval system