KEGG   Achromobacter xylosoxidans A8: AXYL_05358Help
Entry
AXYL_05358        CDS       T01341                                 

Gene name
dgdA
Definition
(GenBank) 2,2-dialkylglycine decarboxylase
  KO
K00596  2,2-dialkylglycine decarboxylase (pyruvate) [EC:4.1.1.64]
Organism
axy  Achromobacter xylosoxidans A8
Brite
KEGG Orthology (KO) [BR:axy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:axy01007]
    AXYL_05358 (dgdA)
Enzymes [BR:axy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.64  2,2-dialkylglycine decarboxylase (pyruvate)
     AXYL_05358 (dgdA)
Amino acid related enzymes [BR:axy01007]
 Aminotransferase (transaminase)
  Class III
   AXYL_05358 (dgdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADP18658
UniProt: E3HV85
LinkDB All DBs
Position
5732351..5733679
Genome map
AA seq 442 aa AA seqDB search
MDETLRAAAREYLVRYGGDTFPNLFTSAKGAIVRDDTGREILDFTSGQMCATIGHNHPAI
VEAVHKAGETAFHFFSGMIPEAVAQLAATVARDWMPAGLSKSIFVNTGSESNEIALRMAK
MHKSGFEILAIGGSWHGVTSGAGSVSYASDRKGYGVPPAGVFVMPEPNAYRPYIAGMDAE
QSALACLEIGLKMFDMASAGRPAAIIVEPVISAGGVLVPPKSYMQALRQAADARGMLLIF
DEAQTAFGRIGYRSGSEYFGVTPDIMSVSKTLGGGLPLAAAVTTPAIEQDVHEKGFTFYT
SHVSDPLPATVGLAVLDTIQREGLIERARTQGDYLRRGLLELQQRHEAIGDVRGLGLLLG
VELVRDRNTREPYHQLGALTTQRCFELGLSMNIRRRPERGSVWRIAPPLTVSNAEIDRAI
AILDQALTESLDKIAKPAARAA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaccctgcgcgccgctgcccgcgaatatctcgtacgctacggcggcgatacc
ttccccaatctgtttacgtccgccaagggcgccatcgtgcgcgacgacaccgggcgcgag
atcctggacttcacctcgggccagatgtgcgccaccatcggccacaaccatccagccatc
gtcgaggcggtacacaaggcgggcgaaaccgccttccactttttcagcggcatgattccg
gaagctgtggcccagctggcagccaccgtcgcacgcgactggatgcccgcaggcctgagc
aagtcgatcttcgtcaacaccggctcggaaagcaacgaaatcgccctgcgcatggccaag
atgcacaagagcggcttcgagatcctggccatcggcggctcctggcacggcgtgaccagc
ggagccggttcggtttcctatgccagcgaccgcaagggctacggcgtgccgcccgccggc
gtgttcgtcatgcccgaacccaacgcctaccgtccttacatcgccggcatggacgccgag
caatccgcgctggcctgcctggagatcggactgaagatgttcgacatggcttccgccggc
aggccggccgccatcatcgtcgagcccgtcatcagcgcgggcggcgtgctggtgccgccc
aagtcctacatgcaggcgctgcggcaggcggccgacgcgcgcggcatgctgctgatcttc
gatgaggcacagaccgcattcggccgcatcggctaccgcagcggctccgagtacttcggc
gtcacgcccgacatcatgagcgtgtccaagacgctgggcggcggcctgccgctggccgcc
gccgttaccacgcccgccatcgaacaggacgtgcacgagaagggcttcaccttctacacc
agccacgtatcggacccgttgcccgccacggtgggcctggccgtgctggataccatccag
cgcgaaggcctgatcgaacgcgcccggacccagggggactacctgcgccgcggcttgctg
gaactgcagcagcgccatgaagccatcggtgacgtgcgcggcctgggcttgctgctgggc
gtggagctggtgcgcgaccgcaatacccgcgaaccctatcaccagctcggcgccctgacc
acgcagcgctgcttcgaactgggcctgtccatgaacatccgtcgccgtcccgaacgcggt
tcggtgtggcgcatcgcgccgcccttgaccgtgagcaacgccgagatcgaccgcgccatt
gcgatcctggatcaggccctgactgagagcctggacaagatcgccaagccggccgcgcgc
gccgcctga

DBGET integrated database retrieval system