KEGG   Achromobacter xylosoxidans A8: AXYL_05682Help
Entry
AXYL_05682        CDS       T01341                                 

Definition
(GenBank) glutathione S-transferase, C-terminal domain protein 13
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
axy  Achromobacter xylosoxidans A8
Brite
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AXYL_05682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ADP18981
UniProt: E3HG78
LinkDB All DBs
Position
complement(6100887..6101585)
Genome map
AA seq 232 aa AA seqDB search
MTDLSAFPITKKWPARHPDRIQLYSLPTPNGVKVSILLEETGLPYEVHRVSFDARDQFSP
EFLSLSPNNKIPAILDPNGPDGKPLALFESGAILIYLASKAGKFLPADTAGRYETLQWIM
FQMGGIGPMFGQLGFFHKFAGKDYEDKRPRDRYAEESKRLLNVLDQRLAGRDWVMGDEYT
IADIAILPWVRNLVGFYGAGELVEFSRFKNVARVLEAFVARPAVTRGLTIPA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctcagcgccttccccatcaccaagaagtggcccgcccggcaccccgaccgc
atccagctgtattcgctgcccacgcccaacggcgtgaaggtgtcgatcctgctggaggag
accgggctgccctacgaggtccaccgggtcagctttgacgcccgggaccagttttccccc
gagttcctgtcgctcagcccgaacaacaagattccggccatcctcgatcccaatggcccc
gacggcaagccgttggcactgttcgagtctggcgcgatcctgatctacctggccagcaag
gcgggcaagttcctgccggcggacacggcggggcgctacgagacgctgcagtggatcatg
ttccagatgggcggcatcggcccgatgttcggccagctgggtttcttccacaaattcgcc
ggcaaggactacgaggacaagcgtccgcgcgaccggtatgcggaggagtccaagcgcctg
ttgaacgtgctggaccaacggctggcggggcgcgactgggtaatgggcgatgaatacacc
attgccgatatcgccatcctgccctgggtgcgcaatctggtgggcttctatggcgcgggc
gagctggtggagttctcgcgcttcaagaatgttgcccgggtgctggaggctttcgtggcc
cgcccggcggtgacccggggcctgacgatacccgcctga

DBGET integrated database retrieval system