KEGG   Achromobacter xylosoxidans A8: AXYL_05943Help
Entry
AXYL_05943        CDS       T01341                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00620  Pyruvate metabolism
axy00680  Methane metabolism
axy01100  Metabolic pathways
axy01120  Microbial metabolism in diverse environments
axy01200  Carbon metabolism
Module
axy_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXYL_05943 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    AXYL_05943 (ppc)
Enzymes [BR:axy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AXYL_05943 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF5347
Motif
Other DBs
NCBI-ProteinID: ADP19239
UniProt: E3HJK7
LinkDB All DBs
Position
6399180..6402029
Genome map
AA seq 949 aa AA seqDB search
MNAMRPQSDSAEPLRHDIRLLGRLLGTVIEECEGKRVFDTIETLRRTAVKFRREGNDADG
KLLEQRVKRLQGSDPNSVARAFSYFLHLSNIAEDRDQNRRQRARAIASDAPERGSLREAV
QTLGRQGVGVARIRRLLAEACVMPVLTAHPTEVQRKSTLDVHREIAAALIQREGTLTPDE
LADLDASLLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRVYGDLSKLLTR
ESAKPFAAPPAPLEPFLRMGSWIGGDRDGNPNVDASTLERALLRQATVLFEHYLQEVHAL
GAELSVTTLLIGVDAELLALAEASGDDSPHRRDEPYRRALVGVYARLAATAQRLTGQNLA
RRSTVAASAYERPEELSADLAVIAASLAAHHGAPIGKLRLAGLQQAVEVFGFHLATVDLR
QSSDVHERALAELFALAGTQRNGKPLDYLALTEEERVELLRAELAQARPLASPWIAYSED
TTRELAVLRAAAAGRARYGKQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGQDIQPE
DGLMVVPLFETIPDLERGADIMAAWLDLPEIRQRVKLAQNGAQEVMLGYSDSNKDGGFLT
SNWSLYQAERALVDVFSARNVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTE
QGEVIQSKYKDAEVGRWHLELLVAAVLESSLAPRAEATSAEDAHMAQHGPAMSFMSETAQ
RTYRGLVYDTPRFADYFFAATPISEIAGLNIGSRPASRKKGQHIEDLRAIPWGFSWAQCR
LMLTGWYGMGSAIEAYLETGAPDAPRSRRGRLAQLREMARDWPAFRTLLSNMEMVLAKSD
LAIAARYAQLVPQRGLRERIFGAISAEHGRTLAMLKLLTQRELLADNPTLQASLRERFAY
IDPLNYLQIDLIRRHRAAQKHPEAEVDKRVQRAIHLTINGIAAGLRNSG
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccatgcgcccgcagtccgattcagcagaacccttgcgtcacgatatccggctg
ttaggccgattactgggcaccgtcatcgaagaatgcgagggcaaacgcgttttcgacacc
atcgaaaccctgcgccgcacggctgtgaagttccgccgcgaaggcaacgacgccgacggc
aaactgctggaacaacgcgtcaagcgcctgcaaggcagcgaccccaactcggtggcgcgc
gccttcagctacttcctgcatctttccaatatcgccgaagaccgcgaccagaaccgccgt
cagcgcgcccgcgccatcgccagcgacgcgccggagcgcggcagcctgcgcgaagccgtg
cagaccctgggccgccagggcgtaggcgtggcgcgcatccgccgcctgctggcggaggcc
tgcgtgatgccggtgctgaccgcgcaccccaccgaagtgcagcgcaagagcacgctggac
gtgcatcgcgagatcgccgccgcgctgatccagcgcgagggcaccctcaccccggacgag
ctggccgacctggacgcctccctgctgggccgcgtggccacgctgtggcagacccgcatg
ctgcgctacacgcgcttgacggtcgccgacgaaatcgagaacgcgctgtcgtactaccgc
agcaccttcctgcaagtcataccccgcgtatacggcgacctgtccaagctgttgacccgc
gaatccgccaaaccgttcgccgcaccgcccgcgccgctggagccgttcctgcgcatgggc
agctggatcggcggcgaccgcgacggcaaccccaacgtcgacgccagcaccctcgaacgc
gcgctgctgcgccaagccaccgtgctgttcgagcactatctgcaagaggtccacgcgctg
ggcgcggaactgtccgtcaccaccctgctgatcggcgtcgacgccgaactgctggcgctg
gccgaggccagcggcgacgactcgccccaccgccgcgacgaaccgtaccgccgcgccctg
gtcggcgtctacgcccgcctggccgccaccgcgcagcgcctgacgggccagaacctggcg
cggcgcagcaccgtcgccgccagcgcctacgaacggccggaagaactgtccgccgacctg
gccgtgatcgccgcctcgctggccgcccaccacggcgcccccatcggcaagctgcgcctg
gcaggactgcagcaggccgtggaagtgttcggcttccatctggccacggtggacctgcgc
caaagctccgacgtgcacgagcgcgcgctggccgaactgttcgccctcgccggcacccag
cgcaacggcaagccgctggactacctggcgctgaccgaagaggaacgcgtcgaactgctg
cgcgccgaactggcgcaggcgcgtccgctggcctcgccctggatcgcctacagcgaagac
accacgcgtgaactcgcggtgctgcgcgccgccgccgccggccgcgcgcgctacggcaag
caggccgtgcgccagaccatcgtgtcgcacaccgaaacgctgagcgacctgctcgaagtc
atggtgctgcagaaggaagccggcctcatcgcccccgccggccaggacatccagcccgag
gacggcctgatggtcgtgccgctgttcgagaccatccccgacttggagcgcggcgccgac
atcatggccgcctggctggacctgccagaaatccgccagcgcgtgaagctggcgcagaac
ggcgcgcaggaagtcatgctgggctattcggacagcaacaaggacggcggcttcctcacg
tccaactggtcgctgtaccaggccgaacgcgcgctggtcgacgtgttctcggcccgcaac
gtgcgcctgcgcctgttccacggccgcggcggttcggtgggccgcggcggcggctccagc
ttcgatgccatcctggcgcagcctccaggcaccgtggccggccagatccgcctgaccgag
cagggcgaagtcatccagagcaagtacaaggacgccgaggtcggccgctggcacctggag
ctcctggtcgccgccgtgctggaatccagtctggcgccgcgcgccgaagccaccagcgcc
gaagacgcgcacatggcccagcacggccccgccatgtcgttcatgtcggagaccgcgcag
cgcacctaccgcggcctggtctacgacactccgcgcttcgccgactacttcttcgccgcc
acgcccatcagcgaaatcgccggcctgaacatcggctcgcggcccgcctcgcgcaagaag
ggccaacacatcgaagacctgcgcgccatcccctggggcttttcctgggcgcaatgccgc
ctgatgctgaccggctggtacggcatgggctcggccatcgaggcctatctggaaaccggc
gcacccgacgcgccccgctcgcgccgcggccgcctggcccagctgcgcgaaatggcgcgc
gactggcccgcgttccgcacgctgctgtccaacatggaaatggtgctggccaagtccgac
ctggcgattgccgcgcgctacgcgcagctggtgccgcaacgcggcttgcgcgaacgcatc
ttcggcgccatcagcgccgagcacggccgcacgctggccatgctcaagctgctgacccag
cgcgaattgctggccgacaaccccacgctgcaagcctcgctgcgcgaacgcttcgcctac
atcgatccgctcaactacctgcagatcgacctgatccgccgccaccgcgcggcgcagaag
catccagaagccgaggtcgacaagcgcgtgcagcgcgccatccacctgaccatcaacggg
attgcggcggggctgcgcaactcgggttag

DBGET integrated database retrieval system