KEGG   Achromobacter xylosoxidans A8: AXYL_06377Help
Entry
AXYL_06377        CDS       T01341                                 

Definition
(GenBank) penicillin-binding protein 1A 2
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00550  Peptidoglycan biosynthesis
axy01100  Metabolic pathways
axy01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AXYL_06377
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AXYL_06377
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:axy01003]
    AXYL_06377
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:axy01011]
    AXYL_06377
Enzymes [BR:axy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AXYL_06377
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AXYL_06377
Glycosyltransferases [BR:axy01003]
 Polysaccharide
  Bacterial polysaccharide
   AXYL_06377
Peptidoglycan biosynthesis and degradation proteins [BR:axy01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AXYL_06377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ADP19670
UniProt: E3HRQ1
LinkDB All DBs
Position
6853958..6856405
Genome map
AA seq 815 aa AA seqDB search
MSKPQNSSKKDKPAKSGSPILRFFVKTGIFFAGLFLCGVLLAGMALALAWPNLPDLNAMT
DYRPRVPLRVYTADRVLIGEFGEERRNVLRFNEIPDVMKSAVLAAEDDRFYQHGGIDWMG
VARAGLTNLISMSKSQGASTITMQVARNFYLSSEKTYSRKFYELLLTFKIESELTKDQIL
ELYMNQIYLGHRAYGFAAASRTYFGKPLSEVTPAEAAMLAGIPKAPSRFNPIANRPRAEL
RQRYVLGRMHSLGYLTEPEYQQAMAQPIVMKSAEGTPAGGYSIHGEYVAELARQLLFNVY
QDNVYSRGINIYTTVQSKDQEAAYRSVREGVLEYTRRAPYPGPEEQLDLPPGTENNPQAL
DEFLDGVFDKFSDSGDLLTALVLSASPTEVKLARSSREIITVTDKKVLGVVARALNDKAK
PEQRIKRGSVVYIRKFGDNWEIINLPSVQAAFVALSPQDGAIRAMVGGFDFYRGNFNRVT
QAWRQPGSNIKPFIYAASLERGLTPGTQISDQPFELTAAQTGSKAWNPKNYGNQYEPMLT
LRQGLYKSKNMVSIRILQAIGPQYAQDYLTRFGFDKARQPAVLPLALGAGSVTPLQLAGA
FSVFANGGYRVTPYLIDRVTDSNGKVIMQSKPVVAGDAAARAIDPRTAWIMDDILRGVAT
YGTAARARVLLKRNDIAGKTGTTNESVDAWFSGYTPSLVATAWLGFDQPKSLGSRETGGG
VAMPIWVDYMQTVLKGVPEEKPRPRPDGLIVENGEFYFSEFPPGQAVARLGLPEADTLGE
FLNGLNGSTSEETRIKVAPGVGTQSNTPWSQKIPF
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccccagaattcctccaagaaagacaagcccgccaagagcggttccccgata
ctgcgattcttcgtcaaaaccggcatcttctttgccggcctgttcctgtgcggcgtactg
ctggccggaatggcgttggcgctggcctggcccaacctgccggacctgaacgccatgacg
gactaccgtcctcgggtgccgctgcgcgtctatacggcggaccgcgtcctgatcggcgaa
ttcggcgaagaacgccgcaacgtgctgcgcttcaacgaaatcccggacgtcatgaagtcc
gccgtgctggcggccgaagacgaccgcttctatcagcacggcgggatcgactggatgggc
gtggcgcgggccggcctgaccaacctgatcagcatgtcgaagtcgcagggcgccagtacc
atcaccatgcaggtggcgcgcaacttctacctttcgtcggagaagacctattcgcgcaag
ttctatgaactgctgctgaccttcaagatcgaatcggagctcaccaaggaccagatcctc
gagctctacatgaaccagatctacctggggcaccgcgcctacggtttcgcggccgcctcg
cgcacctatttcggcaagcctctgtcggaagtcacgcccgcggaagccgccatgctcgcc
ggcatccccaaggcgccgtcgcgtttcaacccgatcgccaatcgtccgcgcgccgaactg
cgccagcgctacgtgctgggccggatgcattcgctgggctacctgaccgaaccggaatat
cagcaggcgatggcccagcccatcgtcatgaagtccgcggaaggcacgccggccggcggc
tattccatccatggcgaatacgtggcggaactggcgcgccaactgctgttcaacgtgtac
caggacaacgtctattcgcgcggcatcaatatctacaccacggtgcagtccaaggaccag
gaagcggcctaccgctccgtgcgcgaaggcgtgctcgaatacacgcgtcgcgcgccctat
cccggccccgaagaacagctggacctgcccccgggcaccgagaacaacccgcaggcgctc
gatgagttcctggacggcgtgttcgacaagttcagcgacagcggcgacctgctgacggcg
ctggtgctgtcggccagccccaccgaagtgaagctggcgcgcagctcgcgcgagatcatc
accgtcaccgacaagaaggtgctgggcgtggtggcgcgcgcgctgaacgacaaggccaag
cccgagcagcgcatcaagcgcggctccgtggtctacatccgcaagttcggcgacaactgg
gaaatcatcaacctgccctcggtacaggcggccttcgtggcgctgtcgccgcaggatggc
gcgatccgcgccatggtcggcggcttcgacttctaccgcggcaacttcaaccgcgtgacg
caggcctggcgccagccgggctcgaacatcaagcccttcatctacgccgcttcgctggaa
cgcggcctgacgccgggcacgcagatctctgaccagcccttcgagctgaccgccgcccag
accggttccaaggcctggaacccgaagaactacggcaatcagtacgagcccatgctgacc
ctgcgtcagggtctgtacaaatccaagaacatggtgtcgatccgtatcctgcaggccatc
ggcccgcaatacgcgcaggactacctgacccgcttcggcttcgacaaggcccgccagccc
gccgtgctgccgctggccctgggcgcgggctcggtcacgcccctgcaactggccggcgcc
ttctcggtgttcgccaacggcggctaccgcgtcacgccctacctgatcgaccgcgtcacc
gacagcaacggcaaggtcatcatgcagtccaagccggtcgtggccggcgacgccgcggcc
cgcgccatcgacccgcgcaccgcctggatcatggacgacatcctgcgcggcgtggccacc
tacggcaccgcggcgcgcgcccgcgtgctgctcaagcgcaacgacattgccggcaagacc
ggcaccaccaacgaatccgtggacgcctggttctccggctacaccccgtcgctggtcgcc
accgcgtggctgggctttgaccagcccaagtcactgggctcgcgcgaaaccggcggcggc
gtcgccatgccgatctgggtcgattacatgcagacggtactcaagggcgtacccgaagag
aagccgcgcccccggcccgacggcctcatcgtggaaaacggcgagttctatttctccgaa
ttcccgcccggacaagcggtggcacgtctgggcctgcccgaagccgacacgctgggtgaa
ttcctcaacggcctgaatggcagcaccagcgaggaaacccggatcaaggtggcgccgggc
gtgggcacgcaaagcaatacgccctggtcccagaagatcccgttctga

DBGET integrated database retrieval system