KEGG   Achromobacter xylosoxidans A8: AXYL_06730Help
Entry
AXYL_06730        CDS       T01341                                 

Gene name
ligD2
Definition
(GenBank) DNA ligase D 2
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:axy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AXYL_06730 (ligD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:axy03400]
    AXYL_06730 (ligD2)
Enzymes [BR:axy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AXYL_06730 (ligD2)
DNA repair and recombination proteins [BR:axy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AXYL_06730 (ligD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ADP20014
UniProt: E3HY60
LinkDB All DBs
Position
pA82:89324..91846
Genome map
AA seq 840 aa AA seqDB search
MPESLKKYREKRNFAVTSEPAGGGAANEAARAFVVQKHWASRLHYDFRLELGGAMKSWAV
PKGPCYDPSVKRMAVQVEDHPIAYNQFEGTIPKGEYGAGKVIIWDEGTWMPIGDPAKGYR
EGQLKFDLAGTKLRGRWALVRIKGKESEKQPPWLLIKDRDEFARDVRDFSVIDEMPDSVV
PLRTPKQRTGRRSREAPAASIGEGNLPGEAADLFESLKPQLATLVDGIPRRGDDWLYEVK
FDGYRMLARVDGKAVKLLTRNGHDWSAKVPHLVTAIQHLNAQSAWIDGEIVVLADNGVPS
FQALQNAFDGKRTRDIVFYAFDLPYIAGRDLRREPLHVRRALLAQLVAPGANDQVRFSES
FDASPTDLIASACRMGLEGIMAKRQSAGYVSRRTDDWVKIKCAKRQEFVIVGYTAPKGGR
LGFGALLLGVYEADGSLRYAGSVGTGFDDRTLSDIKRKLDRLGRKVSSLKSGKPKAGRDV
HWVQPTLVCEVSFAEWTQAGHVRHATFRGIRTDKSARAITREMSIPVAAVEASDAVAPAQ
AGPRAPLRVRSGKLSNPDRVVDPSTGLTKLDLARYYGLVAPLLLEHLANRPVSFVRAPSG
IQGTLFFQKHLDAAIPGVKALPERLHPGHPALLEVSTPEAIMAAAQMNVVEFHTWNAVKS
AIGKPDRLILDLDPGEGVPWATVQQGAQLVRVLLKEIGLEGWLKTSGGKGLHVMVPLRKQ
YDWDTVKAFSEAMVLHLARTLPQLFVAKSGPKNRVGKIFVDYLRNGFGATTVAAWSARAR
PGLGVSVPVAWEELPKLTSGAQWTIAKIHHRLDAANAPWEGVAPQALARPMKALGFFPKS
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgccggagtccctcaagaagtatcgcgaaaagcgaaatttcgcggtcacaagcgaaccc
gccggcggcggtgccgcgaacgaggccgcgcgcgctttcgtagttcaaaagcattgggcc
agtcgccttcattacgatttccgcttggagctcggaggggccatgaaaagctgggcggta
ccgaaaggcccctgctatgacccatcggtcaagcgcatggcggtccaggtggaggaccac
ccaatagcctacaaccaatttgaaggcacaatccctaagggcgagtacggcgcgggcaaa
gtcatcatctgggatgagggcacttggatgccaatcggcgacccggccaagggttatcgg
gaaggccaactgaaattcgacttagccggcaccaagctgcgaggccgttgggcgcttgtt
cggatcaaaggcaaggaatcggaaaagcagccgccgtggctcctcatcaaagacagagat
gaattcgcgcgagatgtgcgggatttcagcgtaatcgacgaaatgccggatagtgtggtg
cctctgcggactccaaagcagcgaacagggcgcagatcgcgggaagctcctgcagcgagc
ataggcgaaggcaatctgccaggcgaagcggcagacctcttcgagtcgctaaaaccgcaa
ctggcgacactggtggatgggatcccgcgtcgtggtgacgattggctttatgaggtgaag
ttcgacgggtaccgtatgctggcgcgcgttgacggcaaagctgtgaagcttctgacccgc
aacggccacgactggagcgccaaggtgccgcaccttgttaccgccatccagcatctgaac
gcgcagtcggcctggatcgacggtgaaatcgtcgtacttgcggacaacggggttccgagt
tttcaagcactccagaatgcttttgatgggaagcggacgcgcgacattgttttctatgcg
tttgacctgccatatatcgctgggagggatttgaggcgcgagcctttgcacgtgcgcaga
gcgctgcttgcacagctggtggccccaggtgcgaacgaccaggtgcgattcagcgagtcc
ttcgacgcgtcgcctactgacctcatcgcttcagcctgtcgcatggggctcgaaggcata
atggccaagcggcaatcggctggctatgtgtcccggcgtacggacgattgggtcaagatt
aaatgcgcgaagcggcaggaattcgtgatcgtaggttacacggcaccgaagggcgggcgg
ctcggatttggcgcgctgctgttgggcgtttacgaagcggacggctcgttgcgctacgcc
ggcagcgtgggcacggggttcgacgaccgcacgttgtcggacataaaacgtaagctcgat
cgcctcgggcggaaggttagttcgctgaaatccgggaagccgaaggcaggccgcgacgtg
cattgggtccaacccacgcttgtctgtgaggtgtcattcgccgaatggacccaggcgggg
cacgtgcgccatgcgacctttcggggaattcggacggataagtcggcgcgcgctatcacc
cgagaaatgtcgatccctgtcgccgcagtcgaagcttcggacgctgtggcgccagcgcaa
gccgggccgcgtgcgccgctccgagttcgatccggaaaactctccaatccagaccgggtt
gtcgacccctcgaccggcctgacgaagctagacctggcacgctattacggccttgtcgcg
ccgctgctgttggaacaccttgcgaaccggcccgtgtcctttgtgcgcgcacccagcggc
attcaaggcacactctttttccagaaacacctagatgcggcgattccaggcgtgaaggcg
ttacccgagcggctgcatcccggtcatcccgcgctgctggaagtgtctacgccggaagcc
atcatggcggcggctcagatgaacgtcgttgaatttcacacttggaacgccgtcaaaagc
gcgattggcaagccggaccgattaattcttgacctggatccgggcgagggggtgccatgg
gcgacagtgcagcagggcgcacagctggtacgcgtgcttctgaaggaaatcggcttggaa
gggtggctcaaaaccagcggtggcaaggggctgcatgtcatggtgccgctgcggaaacaa
tatgactgggacacagtgaaggctttctccgaagcgatggtgctgcatctcgcccgcacg
ttgcctcaactcttcgtggccaaaagcgggccgaagaatcgtgtgggcaagattttcgtg
gactatcttcgtaacggcttcggcgcgacaacggtcgcggcttggtcggcgcgggcccgg
ccaggtctcggcgtatcggtgcccgtcgcttgggaagaactcccgaagctgaccagcggc
gcgcaatggacgatcgcgaaaatacaccaccggctggacgcggccaacgccccttgggaa
ggtgtcgcaccgcaggcgctggcgcgcccgatgaaggcgttgggattcttccccaagtct
tga

DBGET integrated database retrieval system