KEGG   Ilumatobacter coccineus: YM304_01790Help
Entry
YM304_01790       CDS       T02501                                 

Definition
(GenBank) peptidase S12 family protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
aym  Ilumatobacter coccineus
Brite
KEGG Orthology (KO) [BR:aym00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YM304_01790
Enzymes [BR:aym01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YM304_01790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: BAN00493
UniProt: M4ZUW8
LinkDB All DBs
Position
196405..197811
Genome map
AA seq 468 aa AA seqDB search
MRLSALAVVVAVVVGACGSAADVPVPGAAPTSTIGDTGSDRAVFVEVRTTDDSDAPATSP
GRVELGDPTPSTISPTADTVASVSTVVSEIVEAGSDAVIDALPTTIPVVAPVPVVPVVSG
WPAFDQHLMTILDDGSSAVSATVLRNGEVVHEVAIGERTSAGDPVEIGDRYRIASISKLI
TSITVLQLVEAGAIGIDDVVGPRLAALVGVTSPSAGVESITVRHLLTHRSGIAQYENLMF
RRQVESCAEAGATGLSRGLERAPGTTYRYSNLNFCLLGLLIEDVTGDDYEAVVDRELLDP
LGIDGMRLASTFDVGDGDVEHDSDDGRNYMEVLDAAGSWIASPTDIARITDSLDLTTPGW
KPLGPAAHAEMMTITVDPPVPPEPVTDPGTTTTTTIVPPPPTRGYGMGLMIFGSGSFGHT
GTLESTSAMTVRQPDGLTWAITVSGDFPGSGRNLAPIVAEAFRYAGDV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgtccgcgctcgctgtcgtcgtcgctgtcgtggtcggggcctgcggttcggcc
gccgacgtgcccgttccgggcgccgctccgacgtcgacgatcggtgacacgggatccgac
cgagcggtgttcgtcgaggtccggaccaccgacgacagcgacgcaccggccacgtccccc
gggcgggtcgagctcggtgatccgacgccgtcgacgatcagcccgacggccgacacggtg
gcgagcgtttcgaccgtggtgtcggagatcgtcgaggccggttccgatgccgtgatcgac
gcgctgcccaccaccatcccggtcgtggcgccggtgccggtggttccggtcgtgtcgggc
tggcccgccttcgaccagcacctcatgaccatcctcgacgacggttcctccgccgtctcg
gccaccgtgctccgcaacggggaggtcgtccacgaagtcgccatcggcgagcgcaccagc
gccggtgaccccgtcgagatcggcgatcgatatcgaatcgccagcatcagcaagctgatc
acgtcgatcaccgtgttgcagctggtcgaagccggggcgatcggcatcgacgacgtcgtc
gggccacgtctcgccgcgctcgtcggtgtcacgtcaccgagcgcaggcgtcgagtcgatc
accgtccgacacctgctcacccaccggtcgggcatcgcccagtacgagaacctgatgttc
cgacgacaggtcgaatcgtgcgcggaggcgggagccaccggactctcgcgcggactcgaa
cgagcgcccggcaccacctaccgctacagcaacctcaacttctgcctgctcggattgctc
atcgaagacgtcaccggtgacgactacgaagcggtcgtcgatcgcgagttgctcgacccg
ctcggcatcgacggcatgcgactcgccagcacgttcgacgtcggtgacggcgacgtcgaa
cacgactccgacgacggccgcaactacatggaggtgctcgatgccgccggttcctggatc
gcctcgccgaccgacatcgctcgcatcaccgactcgctcgacctgaccaccccgggttgg
aagccacttgggccggccgcccacgccgagatgatgaccatcaccgtcgaccctcccgtt
ccacccgagccggtcaccgaccccggcacgacgacgaccaccacgatcgtcccgccaccg
cccacccggggctacggcatggggctgatgatcttcggcagcggctcgttcggccacacc
ggcacgctcgagagcacgagcgcgatgaccgtgcggcaacccgacggactcacgtgggcg
atcacggtgagcggcgacttccccggctccggccggaacctggcgccgatcgtggccgag
gccttccgctacgccggcgacgtgtga

DBGET integrated database retrieval system