KEGG   Ilumatobacter coccineus: YM304_07280Help
Entry
YM304_07280       CDS       T02501                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
aym  Ilumatobacter coccineus
Pathway
aym00020  Citrate cycle (TCA cycle)
aym00270  Cysteine and methionine metabolism
aym00620  Pyruvate metabolism
aym00630  Glyoxylate and dicarboxylate metabolism
aym00680  Methane metabolism
aym01100  Metabolic pathways
aym01110  Biosynthesis of secondary metabolites
aym01120  Microbial metabolism in diverse environments
aym01130  Biosynthesis of antibiotics
aym01200  Carbon metabolism
Module
aym_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aym_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aym_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YM304_07280 (mdh)
   00620 Pyruvate metabolism
    YM304_07280 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    YM304_07280 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    YM304_07280 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YM304_07280 (mdh)
Enzymes [BR:aym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     YM304_07280 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: BAN01042
UniProt: M4ZX24
LinkDB All DBs
Position
797484..798485
Genome map
AA seq 333 aa AA seqDB search
MTTPVRVAVTGAAGQIGYSLLFRIASGTMLGPDTPVDLQLLEITPALGALEGVRMELDDG
AFPLLNSITCTDDADVAFGDADVAILVGSMPRKAGMERADLLSANGGIFKPQGEALSRSA
KKDVKVLVVGNPANTNALIAMNNAADLDPGRFTAMTRLDHNRAISQLATRLNSQGESVSV
NDIKKMTVWGNHSVTQYPDLSHCEVAGKNALELVGDQEWYANEYIPTVAKRGAAIIDARG
SSSAASAASAAVDHIRDWTLGTPDGDWVSMSVPSDGSYGVPEGIISSFPCVCKDGNYEIV
QGLDINDFSREKIDASAAELVGERDAVTELGLI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactactccagtgcgtgttgctgtcaccggggccgctggccagatcggctacagcctc
cttttccgtatcgcttcgggcacgatgctcggccccgacaccccggtcgacctgcagctc
ctcgagatcacgccggcgctcggcgcgctcgaaggtgtgcgcatggagctcgacgacggt
gccttcccgctgctcaactcgatcacctgcaccgacgacgccgatgtggcgttcggcgac
gccgatgtggcgatcctcgtcggctcgatgccgcgcaaggcgggcatggagcgcgccgac
ctgctctcggcgaacggtggcatcttcaagccgcagggcgaagcgctcagccgctcggcc
aagaaggacgtcaaggtcctcgtcgtcggcaacccggccaacaccaacgccctcatcgcg
atgaacaacgcggccgatctcgacccgggccgcttcaccgcgatgacccgcctcgaccac
aaccgggcgatcagccagctcgccacccgcctcaacagccagggcgagtcggtgtcggtc
aacgacatcaagaagatgacggtgtggggcaaccactcggtcacgcagtaccccgacctc
tcgcactgcgaggtcgccgggaagaacgccctcgaactggtgggcgatcaggagtggtac
gccaacgagtacatccccaccgtcgccaagcgtggcgccgccatcatcgacgctcgcggg
tcgtcgtcggcagcctcggctgcgtcggctgcggtcgaccacatccgtgactggacgctc
ggcacccccgacggcgactgggtctcgatgtcggtgccgagcgacggcagctacggcgtg
cccgagggcatcatcagctcgttcccgtgcgtctgcaaggacggcaactacgagatcgtc
cagggcctcgacatcaacgacttcagccgcgagaagatcgacgcctcggccgccgagctc
gtcggcgagcgtgacgcggtgaccgagctcggcttgatctga

DBGET integrated database retrieval system