KEGG   Ilumatobacter coccineus: YM304_07720Help
Entry
YM304_07720       CDS       T02501                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
aym  Ilumatobacter coccineus
Pathway
aym02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aym00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YM304_07720 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aym02000]
    YM304_07720 (pstB)
Enzymes [BR:aym01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     YM304_07720 (pstB)
Transporters [BR:aym02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    YM304_07720 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_15 AAA_16 AAA_22 RsgA_GTPase AAA_29 Gemin6 AAA TniB Rad17
Motif
Other DBs
NCBI-ProteinID: BAN01086
UniProt: M4ZY61
LinkDB All DBs
Position
854867..855742
Genome map
AA seq 291 aa AA seqDB search
MTEADPTELADSGAVATKQGPSTADEAAAPATVFEARGLNVYYGDFLAVRDVDIDIVEHQ
ITSFIGPSGCGKTTILRCFNRMNDLIDSARVEGSLTYHGVDLYASRVDAVEVRRRIGMVF
QKPNPFPKSIYDNIAYGPRVAGKVKGKSATDDLVERSLRRAALWDEVKDRLSASALGMSG
GQQQRLCIARAIAVEPDVLLMDEPCSALDPIATARIEDLMQELKDEYTIVIVTHNMQQAA
RTSDRTAFFSVEVNPDSDQRTGLMVEVNPTEKIFSSPDDKRTEQYVTGRFG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagctgacccgaccgaactggccgattcgggggccgtcgcaacgaaacaagga
ccctcgaccgccgacgaggcagccgctccggcgaccgtcttcgaagcgcgtggtctcaac
gtctactacggcgacttcctcgccgtgcgcgacgtcgacatcgacatcgtcgagcaccag
atcacctcgttcatcggcccgtcgggctgtggcaagaccaccatcctgcggtgcttcaac
cgcatgaacgacctgatcgactccgcacgcgtcgaaggatcgctcacctatcacggcgtc
gacctctacgcctcgcgagtcgacgcagtggaggtgcgccgacggatcggcatggtcttc
cagaagcccaacccgttccccaagagcatctacgacaacatcgcctacggtccgcgcgtg
gccggcaaggtgaagggcaagtccgccaccgacgacctggtcgagcgctcgctgcgccgt
gccgcactgtgggacgaggtcaaggatcgcctcagcgcctcggcgttgggcatgtcgggt
ggccagcagcagcgtctctgcatcgcccgtgccatcgccgtcgagcccgacgtcttgctg
atggacgagccgtgctccgcgctcgacccgatcgccaccgcccgcatcgaagacctgatg
caggaactgaaagacgaatacacgatcgtgatcgtgacgcacaacatgcagcaggcagcg
cgaacgagcgaccgcacggcgttcttctccgtcgaggtcaaccccgactccgatcagcgc
accggcctgatggtcgaggtcaacccgaccgagaagatcttctcgtctcccgacgacaag
cggaccgagcagtacgtcacggggcggttcggctga

DBGET integrated database retrieval system