KEGG   Ilumatobacter coccineus: YM304_15100Help
Entry
YM304_15100       CDS       T02501                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aym  Ilumatobacter coccineus
Pathway
aym03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aym00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    YM304_15100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aym03400]
    YM304_15100
Enzymes [BR:aym01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     YM304_15100
DNA repair and recombination proteins [BR:aym03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     YM304_15100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAN01824
UniProt: M4ZZW8
LinkDB All DBs
Position
1687899..1688795
Genome map
AA seq 298 aa AA seqDB search
MTVVSIDGREVTLTNLDKVLYPSGFTKAEVVDYHARIAPWAIPHLADRCLTFRRFPDGTD
RDGFFEKRCNKHRPEWVPVSLGPGDRRGGIEYCRIEEPAAMVWAANLAAIELHAPMAHAV
DIDTPSTLVFDFDPGPKTSVVECCQIALATTAVLESVGLQGWCKTSGSKGLQMYVPLNTP
GATHQGAADFALAVGQVLERQLPGKVTTIMAKDVRPGKIFVDWSQNALHKTTIAPYSLRA
RPRPTVSTPVTWDEVESCASGDLDLVFEAGDVLERVDEFGDLFEPVLTLQQELPTPQS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcgtctcgatcgacgggcgcgaggtcacgctcacgaacctcgacaaggtgctg
tacccgtcggggttcaccaaggccgaggtcgtcgactatcacgcccgcatcgcgccgtgg
gcgatcccgcacctcgccgatcgctgcctgacgttccgtcggttccccgacggcaccgat
cgcgacgggttcttcgagaagcggtgcaacaagcatcgtcccgagtgggtgccggtgtcg
ctgggtccgggcgatcggcgtggcggcatcgagtactgccgcatcgaagaaccggccgcg
atggtgtgggccgccaacctggcagcgatcgaactccacgcaccgatggcgcatgcggtc
gacatcgacacgccgagcacgctggtgttcgacttcgatccggggccgaagacctcggtc
gtcgagtgttgccagatcgcgttggcgaccacggcggtgctcgaatcggtcgggctccaa
ggatggtgcaagacctcggggtcgaaggggctccagatgtacgtgccgctcaacaccccc
ggggccacgcatcagggtgcagccgacttcgccctcgccgtcggacaggtgctcgagcgg
caactgcccggcaaggtcaccacgatcatggccaaagacgtgcgccccgggaagatcttc
gtcgactggagccagaacgcgctccacaagaccacgatcgccccgtactcgctgcgcgcc
cggcctcgtccgaccgtgtcgacgccggtcacctgggacgaggtcgagtcgtgcgcgagc
ggcgacctcgacctcgtgttcgaagccggcgacgtgctcgaacgcgtcgacgagttcggc
gacctgttcgaaccggtgctgacactgcagcaagaactcccgacaccgcagtcctga

DBGET integrated database retrieval system