KEGG   Ilumatobacter coccineus: YM304_31700Help
Entry
YM304_31700       CDS       T02501                                 

Definition
(GenBank) putative xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
aym  Ilumatobacter coccineus
Pathway
aym00040  Pentose and glucuronate interconversions
aym00051  Fructose and mannose metabolism
aym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YM304_31700
   00051 Fructose and mannose metabolism
    YM304_31700
Enzymes [BR:aym01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     YM304_31700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 TyeA
Motif
Other DBs
NCBI-ProteinID: BAN03484
UniProt: M5A4W9
LinkDB All DBs
Position
complement(3539153..3540136)
Genome map
AA seq 327 aa AA seqDB search
MASTQRFGAGIWHFATYVDRYATDGYGEPRSVIDAIDLAGQVRDLSVVDLNYPFFGGDFT
NEQVKTALDRNGLGVIGITPEIYTRVFAKGAFTNPDHGVRRLAHDLVTEACDVVRSFGAD
YVKLWPGQDGWDYPFQVDYGELWQASMDGVGQLADENPDLRFVVEYKPREPRVHMSYSSV
ARTLLGIEKIGLPNIGILLDFGHALFGGEAPSDSAQLAIDYGRLFGMDVNDNLRGWDDDM
VAGTVHPIELLEFFYTLRKNNWEGVWQLDQFPFREDSVEAADAAIDFLKACDRALDKMDM
DAMREAQARHDAMGALRIAQQALFSSY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcacgcaacgcttcggcgccggcatctggcacttcgcgacgtacgtcgatcgg
tacgcgaccgacggctacggcgaaccgcgcagcgtcatcgacgcgatcgacctcgccgga
caggttcgagacctgtcggtcgtcgacctcaactatccgttcttcggtggcgacttcacc
aacgaacaggtgaagaccgcactcgaccgcaacggcctcggggtcatcggcatcacgccc
gagatctacacgcgagtgttcgccaagggtgcgttcaccaaccccgaccacggcgttcgg
cggctcgcgcacgacctcgtcaccgaagcgtgcgacgtggtgcgctcgttcggcgccgac
tacgtcaagctgtggcccggccaagacggctgggactatcccttccaggtcgactacggc
gagctgtggcaggcgagcatggacggcgtcgggcaactcgccgacgagaaccccgacctc
cgtttcgtggtcgagtacaagccgcgtgagccgcgcgtgcacatgagctacagcagcgtc
gcccgcacgctgctcggcatcgagaagatcgggctgcccaacatcggcatcctgctcgac
ttcggccacgcactgttcggcggtgaagcgccgtccgactccgcacaactcgccatcgac
tacggccgcctgttcggcatggacgtcaacgacaacctgcgcgggtgggacgacgacatg
gtcgccggaaccgtccatccgatcgagctgctcgagttcttctacacgctgcgcaagaac
aactgggaaggggtctggcagctcgaccagttcccgttccgtgaagactccgtcgaggcc
gccgatgcggcgatcgacttcctcaaggcgtgcgatcgggcactcgacaagatggacatg
gatgccatgcgtgaggcgcaggcacgccacgatgccatgggcgcgctgcgcatcgcccag
caggcgctcttctcgagctactga

DBGET integrated database retrieval system