KEGG   Azoarcus sp. KH32C: AZKH_0128Help
Entry
AZKH_0128         CDS       T02502                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00970  Aminoacyl-tRNA biosynthesis
aza01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aza00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AZKH_0128 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aza03029]
    AZKH_0128 (gatB)
Enzymes [BR:aza01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AZKH_0128 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AZKH_0128 (gatB)
Mitochondrial biogenesis [BR:aza03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AZKH_0128 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: BAL22475
UniProt: H0PYP3
LinkDB All DBs
Position
complement(142028..143485)
Genome map
AA seq 485 aa AA seqDB search
MSRTDWEVVIGLEVHAQLNTASKIFSGASTAFGAEPNVQACAVDIALPGVLPVLNRGAVE
RAIRFGLAIGAEVAPKSVFARKNYFYPDLPKGYQISQFELPVVQGGAITIRVGEGDKAYE
KTVQLTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARALH
ALVRWIDICDGNMQEGSFRCDANVSVRRPGGPLGTRREIKNLNSFRFLQQAIDYEVQWQI
DTIEDGGKIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLVISQDWKTRVQSEM
PELPAAMKARFIDQWSLSAYDATTLTASKEVATFFQATVDAAGVALAKPCANWVMGDLAA
RLNKAELDIAASPVSPAQLAGLVARITDGTISNNIGKKVFEALWNGEGESADAIIEAQGL
RQTNDAGAIEAMIDEVLAANQKSVDEFRAGKEKAFNALVGQVMKASKGKANPAQVNELLK
RKLEG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacggattgggaagtcgtcatcggcctggaagtccacgcccaactcaacacc
gcctcgaagattttctccggcgccagtaccgcctttggcgccgagccgaacgtacaggcc
tgtgccgtcgacatcgcactgcccggcgtgctgccggtgctcaaccgcggcgccgtcgaa
cgcgcgatccgcttcggactcgcaatcggcgccgaagtcgcgccgaagagcgtgttcgcg
cgcaagaactacttctatccggacctcccgaagggctatcagatcagccagttcgagctg
ccggtcgtgcagggcggcgcaatcacgatccgcgtcggcgaaggcgacaaggcgtatgaa
aagaccgtgcagctgacccgcgcccacctcgaggaagacgccggcaaatcgctgcacgaa
gacttccacggcatgagcggcatcgacctcaaccgtgccggcacaccgctcctcgagatc
gtctccgagcccgacatgcgttcctcggccgaggccgtcgcctacgcccgcgcgctgcac
gcgctcgtgcgctggatcgacatctgcgacggcaacatgcaggaaggctccttccgctgc
gacgccaacgtttccgtgcgccgccccggcggccccctcggcacgcgccgcgagatcaag
aacctgaactccttccgcttcctgcagcaggcgatcgactacgaggtccagtggcagatc
gacaccatcgaggacggcggcaagatccagcaggcgaccgtgctcttcgaccccgacacc
ggcgagacgcgcatgatgcgttcgaaggaagacgcgcacgactaccgctacttccccgac
cccgacctgctgccgctcgtgatctcgcaagactggaagacgcgcgtgcagagtgaaatg
cccgagttgcccgccgcgatgaaggcccgcttcatcgatcagtggagcctctcggcctac
gacgcgacgacgctgaccgcctccaaggaggttgcgaccttcttccaggccaccgtcgat
gccgccggcgtcgcgctcgccaagccctgcgccaactgggtcatgggcgatctcgccgcg
cgcctgaacaaggccgaactcgatatcgccgcgtccccggtgtcgccggcgcagctcgcg
ggactggtcgcgcgcatcaccgacggcacgatttcgaacaatatcggcaagaaagtgttc
gaagccttgtggaacggcgaaggtgagagcgccgacgcgatcatcgaagcccaaggcctg
cgccagaccaacgacgccggagcgatcgaggcgatgatcgacgaagtgctcgcggcgaac
caaaaatcggtcgacgaattccgcgccggcaaggaaaaggccttcaacgcactggtcggc
caagtcatgaaggcgagcaagggcaaggccaaccctgcgcaggtgaatgaactcttgaaa
cgcaagctagaaggctaa

DBGET integrated database retrieval system