KEGG   Azoarcus sp. KH32C: AZKH_0135Help
Entry
AZKH_0135         CDS       T02502                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00550  Peptidoglycan biosynthesis
aza01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZKH_0135
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AZKH_0135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aza01011]
    AZKH_0135
Enzymes [BR:aza01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AZKH_0135
Peptidoglycan biosynthesis and degradation proteins [BR:aza01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AZKH_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: BAL22482
UniProt: H0PYQ0
LinkDB All DBs
Position
148458..150419
Genome map
AA seq 653 aa AA seqDB search
MEFRTPDEELASFRRRVLVAGLFVMVCFGVLAARFYFLQVVRYDYYHTRAEDNRIALLPI
VPSRGAIVDRNGVPLARNYAAYTLEITPSRVADLDATIDALSEIIQIEPRDRRRFRKLLE
DSKNFESLPIRTRLTEEEVARFIARRYRFPGVEVQARLFRDYPQGELASHVIGYIGRINQ
RDQDRIEDQGLTANYRGSDYIGKGGLEMSYEAELHGATGAEQVEVNAGGRAVRQLARVPG
VPGNDLELTLDIEMQKVAEAAFGNRRGALVAIDPATGGILSLVSKPTFDPNLFVDGISND
DWKALNESPDHPLVNRAILSAYPPGSTFKPFMALAGLTAGKRTITQTISDPGYFMFAGHR
YMDDQPGGHGTVDLRKSIVVSCNTYYYQLANDLGIDGIANFMRPLGFGSRTGIDLNGEAE
GVLPTPEWKKKRFRNKEHQKWFGGETISVGIGQGYNAYTPLQLANALAAVINDGKVFRPH
LVRNVVNPVTGERRPVAPEPLRQVQIKPEYLAAVRQAMVDVNKAGTGARAFAGAPYSVGG
KTGTAQVFSLHGQKYVAGRVTEKLRDHSWFIAYAPADKPTIAMAVLVENGGFGAQSAAPI
ARQVIDFHLLGKRPNQPAGEDAGAVDEGDDRHDPAEHDAPAVPGFFGNDSEGR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggaattccgtactcccgacgaggaactggcgagtttccgccgccgcgtcctggtggcg
ggcctgttcgtgatggtctgcttcggcgtcctcgcggcgcgcttctatttcctgcaggtc
gtccgctacgactactaccacacgcgggccgaggacaaccgcatcgcgctgctgccgatc
gtgcccagccgcggggctatcgtcgaccgcaacggcgtgccgctcgcgcgcaactacgcg
gcgtacacgctcgagatcacgccttcgcgcgtcgcggatctcgacgcgacgatcgatgcg
ctgtcggagatcatccagatcgaaccgcgcgaccggcggcgcttccgcaagctgctcgag
gacagcaagaacttcgagagcctgccgatccgcacgcgcctgaccgaggaggaggttgcc
cgcttcatcgcgcgacgctatcgcttccccggggtcgaggtgcaggcgcgcctcttccgc
gactacccgcagggtgagctcgcgtcgcacgtgattggctacatcgggcgcatcaaccag
cgcgaccaggaccgcatcgaggaccagggcctgacggcgaactaccgcggctccgactac
atcggcaagggcgggctcgagatgagctacgaggccgaactgcatggcgcgaccggcgcc
gagcaggtcgaggtcaatgccggcgggcgcgcggtgcgccagctcgcgcgcgttcccggc
gtgccgggcaacgacctggagctcacgctcgatatcgagatgcagaaggtcgcggaagcg
gcgttcggcaaccggcgcggcgcgctcgtcgcgatcgacccggctaccggcggcatcctg
tcactggtgtcgaagcccactttcgacccgaacctcttcgtcgacggcatctcgaacgac
gactggaaggcgctcaacgagtcgccggaccatccgctcgtgaaccgcgcgatcctcagc
gcctatccgccgggctcgaccttcaagcccttcatggcgctcgcgggtctgacggcgggc
aagcgcacgatcacgcagacgatctcagacccgggctacttcatgttcgccggccatcgc
tacatggacgatcagcccggcggacacggcacggtcgatctgcgcaagtcgatcgtcgtg
tcgtgcaacacctattactaccagctcgccaacgacctcggcatcgacggcatcgcgaac
ttcatgcgtccgctgggcttcggctcgcgcaccggcatcgacctcaatggcgaagcggaa
ggcgtgctgccgacgccggagtggaagaagaagcgcttccgcaacaaggaacaccagaag
tggttcggcggcgagacgatctcggtcggcatcggccagggctacaacgcctacacgccg
ttgcagctcgccaacgcactggcggcggtcatcaacgacggcaaggtgttccgcccgcac
ctcgtacgcaacgtcgtcaatcccgtcaccggcgagcgacggccggtcgcgccggagccg
ctgcgccaggtgcagatcaagccggagtacctcgccgcggtgcgccaggcgatggttgat
gtgaacaaggccggtaccggcgcgcgcgccttcgccggggcaccctattcggtgggcggc
aagaccggtaccgcgcaggtgttctcgctgcacggtcagaagtacgtcgccgggcgcgtg
accgagaagctgcgcgaccactcgtggttcatcgcctacgcgccggccgacaagccgacg
atcgcgatggcggtgctggtcgaaaacggcggtttcggtgcacagtcggcggcgccgatc
gcgcgccaggtgatcgacttccacctgctcggcaagcgtccgaaccagccggcgggcgag
gatgccggggcggtcgacgaaggcgatgaccgccacgatccggccgagcacgacgccccc
gccgttccggggttcttcggcaacgattcggagggacgctga

DBGET integrated database retrieval system