KEGG   Azoarcus sp. KH32C: AZKH_0138Help
Entry
AZKH_0138         CDS       T02502                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00550  Peptidoglycan biosynthesis
aza01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZKH_0138 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aza01002]
    AZKH_0138 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aza01011]
    AZKH_0138 (dacC)
Enzymes [BR:aza01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AZKH_0138 (dacC)
Peptidases and inhibitors [BR:aza01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AZKH_0138 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:aza01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AZKH_0138 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: BAL22485
UniProt: H0PYQ3
LinkDB All DBs
Position
152652..153779
Genome map
AA seq 375 aa AA seqDB search
MRFFLALLFSLISLAASAQNVPPPALAARAWLLMDHATGQVLAAQEPDSRIEPASLTKLM
TAYLTFAALKSGSIKLEQTVPVSEKAWRMEGSRMFIQPDKPVTVGELVQGMIIQSGNDAC
VALSELIAGGEDSFAALMNREAQRLGMKNTHYMNSTGLPDPDHYTTARDLSVLAGAISRD
FPEYYHYYSQKGYSYNGITQPNRNRLLWLDPSVDGLKTGHTAAAGYCLIASALRGPRRLV
SVVLGTESDTVRAQESLKLLNYGFQFFDTAKLYSANQELSRFRVWKGQINELPVGFTQDF
VMSLPKGQAEKLQTELTSMQPVVAPLQKGQPVGTLKVSLDGKAIGEYPVVALQDVPVAGF
FGRLWDALLMWIKSL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcttcctcgccctgctgttttcgctgatttcccttgccgcatctgcacaaaac
gtcccgccccccgcactcgccgctcgtgcgtggctgctgatggatcacgccacgggtcag
gtgctggccgcgcaggagcccgattcccgcatcgagccggcgtcgctgaccaagctgatg
acggcctacctgacctttgcggccctgaagagcggcagcatcaagctcgagcagaccgtg
ccggtgtcggaaaaggcctggcgcatggaaggctcgcggatgttcatccagcccgacaag
ccggtgacagtcggtgagctcgtgcagggcatgatcatccagtccggcaacgacgcctgc
gtcgcgctctccgagctgatcgccggcggcgaagactcctttgccgcgctgatgaaccgc
gaggcgcagcgcctgggcatgaagaacacccactacatgaactccaccggcctgccggat
cccgaccactacacgacggcgcgcgacctgtcggtgctcgccggtgcgatctcgcgcgac
ttccccgagtactaccactactactcgcagaagggatacagctataacggcatcacccag
ccgaaccgcaaccgcctgctgtggctcgatccctcggtcgatggcctcaagaccgggcac
accgcggccgccggctactgcctgatcgcctccgcgctgcgcggcccgcgtcgcctcgtg
tcggtcgtgctcggcaccgagtccgacaccgtgcgcgcgcaggaatcgctgaagctgctg
aactacggcttccagttcttcgacaccgccaagctctactcggccaaccaggagctgtcg
cgcttccgcgtctggaagggccagatcaacgaactgccggtcggcttcacgcaggacttc
gtgatgtcgctgccgaagggccaggccgagaagctgcagaccgaactgaccagcatgcag
cccgtcgtcgcgccgctgcagaagggccagccggtcggcacgctgaaggtctcgctcgac
ggcaaggcgatcggcgaatatccggtcgtcgcgctgcaggatgtgccggtcgcgggcttc
ttcgggcgcctgtgggacgcgctgctgatgtggatcaagagcctgtaa

DBGET integrated database retrieval system