KEGG   Azoarcus sp. KH32C: AZKH_0430Help
Entry
AZKH_0430         CDS       T02502                                 

Definition
(GenBank) glutathione S transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AZKH_0430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aza02000]
    AZKH_0430
Enzymes [BR:aza01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AZKH_0430
Transporters [BR:aza02000]
 Other Transporters
  Pores ion channels [TC:1]
   AZKH_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_3 GST_N_2 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: BAL22776
UniProt: H0Q2Y1
LinkDB All DBs
Position
complement(489471..490079)
Genome map
AA seq 202 aa AA seqDB search
MKLYFSPGACSLSPHIVLCELALPHSLEKVNLKTHTTADGVDYYTINPKGYVPALRLDDG
QLLTEGPAIVQYLADRKPEAHLLPPPGTVERARVHEWLTFIGTEIHKNFSALFGPDVSAD
WKSAARKAIESRFDFIDKTLADRDYLTGSQFTVADAYLFTIAGWAPHVEIDLARWPALAA
FHKRVAARPAVQEAMRAEGVLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctatttcagccccggcgcctgctcgctgtccccgcatatcgtgctgtgcgaa
ctggccctgccccattcgctcgaaaaggtgaacctgaagacgcacaccactgccgacggc
gtcgattactacacaatcaacccgaaaggctacgtcccggcgttgcggctcgacgacggt
cagttgctgaccgaaggtccggcgatcgtccagtatctcgccgaccgtaagcccgaggct
cacctgctgcccccgcccggcacggtcgaacgcgctcgcgtgcacgaatggctgaccttc
atcggcaccgagatccacaagaacttcagcgccctcttcggccccgatgtctcggcggac
tggaagtctgcggcgcgcaaggcgatcgagagccgcttcgacttcatcgacaagaccctc
gcggatcgcgactatctgaccggatcgcagttcaccgtcgccgacgcctacctcttcacg
attgcgggctgggccccccacgtggaaatcgacctcgcccgctggccggcactggccgcc
ttccacaaacgcgtcgccgcgcgcccggccgtgcaggaagcaatgcgtgccgaaggcgtt
ctgaaatag

DBGET integrated database retrieval system