KEGG   Azoarcus sp. KH32C: AZKH_0987Help
Entry
AZKH_0987         CDS       T02502                                 

Gene name
rpiA
Definition
(GenBank) ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00030  Pentose phosphate pathway
aza00710  Carbon fixation in photosynthetic organisms
aza01100  Metabolic pathways
aza01110  Biosynthesis of secondary metabolites
aza01120  Microbial metabolism in diverse environments
aza01130  Biosynthesis of antibiotics
aza01200  Carbon metabolism
aza01230  Biosynthesis of amino acids
Module
aza_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
aza_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aza_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AZKH_0987 (rpiA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZKH_0987 (rpiA)
Enzymes [BR:aza01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     AZKH_0987 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: BAL23323
UniProt: H0PXY1
LinkDB All DBs
Position
complement(1081846..1082514)
Genome map
AA seq 222 aa AA seqDB search
MTQDELKKAAALAALDYIEDGTIVGVGTGSTVNHFIDGLAGIKDRIAGAVSSSEASSRRL
ASYGIPVIDLNDVTDLSVYVDGADEIDDGFAMIKGGGGALTREKIVAAVADRFICICDAS
KLVGCLGAFPLPVEVIPMARAYVERELRHLGGKPVLREGFTTDNGNVILDVHGLRIPEPK
ALETEIDHITGVVTNGLFARRGADLLLLATPQGVERRVATKG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggacgaacttaaaaaggctgctgccctcgcggcgctggactacatcgaggac
ggcacgatcgtcggcgtcggcaccggctcgacggtcaaccacttcatcgacggactcgcc
gggatcaaggaccgcatcgccggcgcagtgtcgagttcggaggcgagttcgcggcggctc
gcctcgtacggcatccccgtgatcgacctgaacgacgtgaccgacctgtcggtttatgtc
gatggcgccgacgagatcgacgacggcttcgcgatgatcaagggcggcggcggcgcattg
acgcgcgagaagatcgtcgcagccgtggccgatcgcttcatctgcatctgcgatgcctcc
aagctcgtcggctgcctcggtgcctttccgctgccggtcgaggtgatcccgatggcgcgc
gcctatgtcgagcgggagctgcggcatctcggcggcaagccggtgttgcgcgaaggcttc
acgaccgacaacggcaacgtcatcctcgatgtccatggcctgcgcatccccgaaccgaag
gccctcgagaccgaaatcgaccacattaccggcgtggtcacgaacgggctgttcgcgcgt
cgcggcgcggatctgctgctgctggcgactccgcagggcgtcgagcgccgggtggcgacc
aagggctga

DBGET integrated database retrieval system