KEGG   Azoarcus sp. KH32C: AZKH_1616Help
Entry
AZKH_1616         CDS       T02502                                 

Gene name
aorA
Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00030  Pentose phosphate pathway
aza01100  Metabolic pathways
aza01120  Microbial metabolism in diverse environments
aza01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AZKH_1616 (aorA)
Enzymes [BR:aza01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AZKH_1616 (aorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: BAL23937
UniProt: H0Q3J4
LinkDB All DBs
Position
1808813..1810660
Genome map
AA seq 615 aa AA seqDB search
MGWNRKILRVNLTQGTCKEEPLNMEWANDYLGSRGLSSKYLVSEIDPKVDPLSPDNKMIM
GTGPLTGTMASTGGRYTVTTKGPLTGAIACSNSGGFFGAEMKFAGWDMIIFEGRSPKPVY
LFLENDKAELRDATHLWGKSCWETEETIKTQHQDPLIRVSSIGLAGENQVMFACIVNDLH
RAAGRSGVGAVMGSKNLKAVAIRGTKGVSGIKDFGAFLKATQDAKKVLADNAVTGQGLPK
YGTQVLMNVINEVGALPTRNHRDVQFEEASKISAEAMHEKRETDGKTHLITNAACFGCTI
ACGRISQLDQNHFTVKNSPKYWGASGGLEYEAAWALGANNGVGDLEALQYANMLCNEQGM
DPISFGATVSAAMELYEMGVLTKEQIGMEAPFGSAAALARFAEMTATGEGFGKEIGLGSA
RLCAKYGHPELSMSVKKQEFPAYDSRGIQGIGLAYATSNRGACHLRAYTVASEVLGIPVK
TDPLATEGKPELVKAFQDATAVFDAAGVCVFTSFAWTLADVQPQVAAACDGDWSMEKLNQ
VGERIWNMERQFNLAAGLSGKDDNLPTRLTTEPAKTGPAKGMVNRLGEMLPEYYKVRGWT
PDGVPTPETLSRLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggatggaatcgcaagatcctgcgggtgaacctgactcagggcacgtgcaaggaagag
ccgctcaacatggaatgggcgaacgactacctcggctcgcgcgggttgtcgtcgaagtat
ctggtgtcggagatcgacccgaaggtcgaccctctgtcgcccgacaacaaaatgatcatg
ggaaccggtcctctgaccggcacgatggcgtcgaccggtggccgttacaccgtcacgacg
aaaggaccgctgaccggcgcgatcgcctgttcgaactcgggcggcttcttcggtgccgaa
atgaagttcgccggctgggatatgatcatcttcgagggacgttccccgaagccggtctat
ctgttccttgagaacgacaaggctgagctgcgcgacgccacgcacctgtggggcaagagc
tgctgggaaaccgaggaaacgatcaagacccagcaccaggatccgctgatccgcgtgtcc
tcgatcgggctcgcgggcgagaaccaggtcatgttcgcctgtatcgtcaatgacctgcat
cgcgccgccgggcgctccggcgtcggcgccgtcatgggttcgaagaacctcaaggcggtc
gcgatccgcgggaccaagggcgtctccggcatcaaggacttcggcgccttcctgaaggcg
acgcaggacgcgaagaaggtcctcgccgacaacgccgtcaccggccagggcctgccgaag
tacggcacccaggtcctgatgaacgtcatcaacgaagtcggcgcgctgcccacccgcaac
caccgggacgtgcagttcgaggaggcctccaagatttccgccgaggccatgcacgagaag
cgcgagaccgacggcaagacccacctcatcacgaacgccgcctgcttcgggtgcacgatc
gcctgcggacgcatctcgcagctcgaccagaatcacttcaccgtcaagaacagcccgaag
tattggggcgcctccggcggcttggaatatgaagcggcgtgggcgctcggtgcgaacaac
ggcgttggcgacctcgaagcgctgcagtacgcgaacatgctgtgcaacgagcagggcatg
gacccgatctccttcggcgcgaccgtcagtgccgcaatggaactgtacgagatgggcgtg
ctgaccaaggagcagatcggcatggaagcgcccttcggctcggccgcggcgctcgcccgc
ttcgccgagatgacggcgaccggcgaaggcttcggcaaggaaatcggcctcgggtcggcg
cgtctgtgcgcgaagtacggccacccggaactgtcgatgagcgtcaagaagcaggagttc
ccggcctacgattcgcgcggcatccagggtatcggtctcgcgtacgcgacctccaatcgc
ggagcctgccacctccgtgcctacacggtcgcatccgaagtgctgggcattcccgtcaag
accgacccgctggccaccgagggcaagcccgaactcgtcaaggccttccaggacgcgacc
gcggtgtttgatgccgcaggggtgtgcgtattcacgtcgttcgcgtggaccttggccgat
gtgcagccccaggtcgccgcggcgtgcgatggcgactggtcgatggagaaactcaatcag
gtgggcgagcggatctggaacatggagcgacagttcaacctcgccgccggtctctccggc
aaggacgacaacctgccgacgcgactgacgacggaacccgcgaagaccggcccggcgaag
ggcatggtgaaccgtctcggcgagatgctgcccgagtactacaaggtgcgcggctggacg
cccgacggcgtgcctacgccggaaaccctgtcgcggctcggcctctga

DBGET integrated database retrieval system