KEGG   Azoarcus sp. KH32C: AZKH_3422
Entry
AZKH_3422         CDS       T02502                                 

Gene name
badK
Definition
(GenBank) cyclohex-1-ene-1-carboxyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00362  Benzoate degradation
aza01100  Metabolic pathways
aza01120  Microbial metabolism in diverse environments
aza01220  Degradation of aromatic compounds
Module
aza_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZKH_3422 (badK)
Enzymes [BR:aza01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     AZKH_3422 (badK)
SSDB
Motif
Pfam: ECH_1 ECH_2 IspD Kelch_6
Other DBs
NCBI-ProteinID: BAL25711
UniProt: H0Q212
LinkDB
Position
3803134..3803931
AA seq 265 aa
MSKEQSMTTTNVILTETHDRVALIRLNRPQVFNALNDEVMDALGAALDAYSADDSIACVV
ITGNDKAFAAGADIAAMKYWSYMDVYKTDFITRNWERLKSFRKPVIAAVSGLALGGGCEL
AMMCDIVYAATDARFALPEVKLATVPGCGGTQRLPRAVGKAKAMEMCLTGRMMDAAEAER
SGLVSRTFPAEQLLEEALATARLISGYSLPVLMMMKEAVNRAFEAPLSEGLLFERRTLHA
SFALEDQKEGMAAFTEKRQPAFGHR
NT seq 798 nt   +upstreamnt  +downstreamnt
atgagcaaggaacaaagcatgactacgaccaacgtcatcctgaccgagacgcacgaccgc
gtcgcactgatccgcctcaaccgcccgcaggtcttcaacgctctcaacgatgaggtgatg
gacgccctcggcgccgcgctcgacgcctactccgccgacgacagcatcgcctgcgtcgtc
atcaccggcaacgacaaggccttcgccgccggggccgacattgcggcgatgaagtactgg
agctacatggacgtctacaagacggacttcatcacccgcaactgggaacgcctcaagagc
ttccgcaaaccggtgatcgctgccgtctccggcctcgcgctcggcggcggctgcgagctc
gcgatgatgtgcgacatcgtctacgccgcgaccgacgcgcgcttcgcgctgccggaggtc
aagctcgccaccgtccccggctgcggcggcacacagcgcttgccgcgcgccgtcggcaag
gcgaaggcgatggagatgtgcctcaccggccgcatgatggacgcggccgaagccgagcgc
agcggcctcgtgtcgcgcactttccccgccgagcagttgctcgaggaagcgctcgccacc
gcaagactgatctccggctactcgctgcccgtcctgatgatgatgaaggaagccgtcaat
cgcgccttcgaggctccgctcagcgagggactgctcttcgaacgacgcacgctgcatgcc
tccttcgctctggaggaccagaaggaagggatggcggccttcaccgaaaagcgtcagccc
gcgttcggccaccgttaa

DBGET integrated database retrieval system