KEGG   Azoarcus sp. KH32C: AZKH_3724Help
Entry
AZKH_3724         CDS       T02502                                 

Gene name
dd1
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00473  D-Alanine metabolism
aza00550  Peptidoglycan biosynthesis
aza01100  Metabolic pathways
aza01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AZKH_3724 (dd1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZKH_3724 (dd1)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AZKH_3724 (dd1)
Enzymes [BR:aza01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AZKH_3724 (dd1)
Peptidoglycan biosynthesis and degradation proteins [BR:aza01011]
 Precursor biosynthesis
  Amino acid ligase
   AZKH_3724 (dd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATPgrasp_ST RimK ATP-grasp_4 CPSase_L_D2 TTL
Motif
Other DBs
NCBI-ProteinID: BAL26008
UniProt: H0Q4G9
LinkDB All DBs
Position
complement(4133908..4134837)
Genome map
AA seq 309 aa AA seqDB search
MSEMNMKERFGKVAVLLGGTSAEREVSLMSGNAVLSALRDAGVDAHGFDPVERDLHVLKE
QGFDRAFIALHGRGGEDGTVQGMLELLKIPYTGSGVMASALSMDKWRTKMVWAACGLPTP
RYAILHADSDWDAIVAELGLPIFVKPVHEGSSMGATKVTEAGQLKAAWELAARFDDLVIA
EEFITGAELTAPFLHDRALPLIRIEAPGGNYDYQHKYFTDDTRYLCPCGLPEAKEAELQA
LVMKCAQVLGCRGWGRADLILTDDGRPYLLEMNTSPGMTGHSLVPMSARVAGMNFTELCL
SILEDARLG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatgaacatgaaggaaagattcggaaaggtggcggtactgcttggcggtacc
tccgcggaacgtgaagtctcgctgatgtcgggcaatgccgtgctgtcggcgctgcgcgat
gcgggcgtcgatgcacatggcttcgatcccgtcgagcgcgacctgcatgtcctcaaggag
cagggcttcgaccgcgccttcatcgcgctgcatggccgtggcggcgaagacggcacggtg
cagggcatgctcgagctgctgaagatcccgtatacgggcagtggcgtgatggcatcggcg
ttgtcgatggacaagtggcgtaccaagatggtgtgggccgcgtgtggcctgccgacgcct
cgttatgccatcctgcatgcggattcggactgggacgcgatcgtcgccgagctcggcctg
ccgatcttcgtcaagccggtgcacgaaggctcgagcatgggcgcgaccaaggtcaccgaa
gccgggcagttgaaagccgcgtgggaactcgccgcgcgcttcgacgacctcgtgattgcc
gaggaattcatcaccggtgccgagctcaccgcgcctttcctgcatgatcgggccttgccc
ctgatccgcatcgaggcgccgggcggcaactacgattaccagcacaaatacttcaccgac
gacacccgctacctctgcccctgcgggctgcccgaggcgaaggaagccgagttgcaggcg
ctcgtgatgaagtgcgcccaggtgctgggctgccgcggctggggccgtgccgacctcatc
ctgactgacgacggccgtccctatctgcttgaaatgaacacctcgccgggcatgaccggg
cactccctcgtgccgatgtccgcgcgcgttgcgggcatgaatttcactgagctgtgtctc
tcgatcctcgaggatgcccgccttggctga

DBGET integrated database retrieval system