KEGG   Azorhizobium caulinodans: AZC_0251Help
Entry
AZC_0251          CDS       T00609                                 

Definition
(GenBank) phage SPO1 DNA polymerase-related protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
azc  Azorhizobium caulinodans
Pathway
azc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:azc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AZC_0251
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:azc03400]
    AZC_0251
Enzymes [BR:azc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     AZC_0251
DNA repair and recombination proteins [BR:azc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     AZC_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BAF86249
RhizoBase: AZC_0251
UniProt: A8IJ52
LinkDB All DBs
Position
292693..293286
Genome map
AA seq 197 aa AA seqDB search
MTGPEALAALARDAANCIRCPLYRDATQTVFGEGAADAPLMLVGEQPGDQEDRKGHPFVG
PAGGVLDRALEAAGIARGAVYVTNAVKHFKFERRGKRRLHKGPNAGEIAACRWWLDRELA
LVRPSLVVALGASAAHALLGRAVTISRTRGRVMEASGDVRLLVTTHPSAILRVPDAEARA
KAFDALVADLVVAREVA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggccctgaggcgctggcggcgctcgcccgagatgcggcgaattgcatacgctgt
ccgctctatcgcgatgccacgcagacggtgttcggcgagggggccgccgatgcgccgctg
atgctcgtgggcgagcagccgggcgatcaggaggaccgcaagggccatcccttcgtcggc
ccggccggtggcgtgctggaccgggcgctggaggcggcgggcatcgcgcgcggcgcggtc
tatgtcaccaatgcggtgaagcacttcaagttcgagcggcggggcaagcgccggctgcac
aaggggccgaatgcgggcgagatcgccgcctgccgctggtggctggaccgggaactggcg
ctcgtgcggccgtcgctcgtcgtggcgctgggggcgagcgccgcccatgcgctgctcggc
cgggcggtcaccatctcgcggacgcgcggtcgggtgatggaggcgtcgggcgacgtgcgc
ctgctggtgacgacccatccctccgccatcctgcgtgtgccggacgctgaagcgcgggcc
aaggccttcgatgctttggtggcggatctcgtggtggcgcgtgaggtggcctga

DBGET integrated database retrieval system