KEGG   Azorhizobium caulinodans: AZC_0314Help
Entry
AZC_0314          CDS       T00609                                 

Gene name
argJ
Definition
(GenBank) arginine biosynthesis protein
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00220  Arginine biosynthesis
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01130  Biosynthesis of antibiotics
azc01210  2-Oxocarboxylic acid metabolism
azc01230  Biosynthesis of amino acids
Module
azc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AZC_0314 (argJ)
Enzymes [BR:azc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     AZC_0314 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     AZC_0314 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: BAF86312
RhizoBase: AZC_0314
UniProt: A8IJJ2
LinkDB All DBs
Position
363284..364525
Genome map
AA seq 413 aa AA seqDB search
MSASISPLAPSALPEVPPVPGVRFATAEAGIRYQGRTDALLVAFDKGTAVAGVTTRSLCP
SAPVEWCREALKKGKARGLVVNSGNANAFTGLKGRESTALTARIAADALGCKPTEIFLAS
TGVIGEPLDATKFQGVMGDMAGRLAAGPWEGPARAIMTTDTFPKLATAQVPFGNTTVTIA
GIAKGAGMIAPDMATMLSFVFTDAPIAAPVLQKLLSKLVVNSFNAVTVDGDTSTSDTLLL
FATGAAKEVGAPAVKDSADPVLRPFRKALKAVLNDLAEQVARDGEGARKLIRVHVSGAVS
KSSARRIAFSIANSPLVKTAVAGEDANWGRVVMAVGKAGEPADRDRLAISFGDIRVAAEG
ARDPSYDEQVVSDYMKGDVIDIRVDLGLGKGADRVLTCDLTKEYVAINGDYRS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgtccatctccccgctcgctccgtccgccttgcccgaggtgccgcctgtgccg
ggcgtgcgtttcgccaccgccgaggcgggcattcgctaccagggccgcaccgatgcgctg
ctcgtggcgttcgacaagggaacggccgtcgcgggcgtcacgacccgctcgctctgcccc
tccgcgcctgtcgagtggtgccgcgaggccctgaagaagggcaaggcgcgcggcctcgtc
gtcaattctggcaatgccaatgccttcaccggcctcaaagggcgtgagtccaccgcgctg
acggcgcgcatcgccgccgatgcgcttggctgcaagcccacggagatcttcctcgcctcc
accggcgtcatcggcgagccgctggatgccaccaagttccagggcgtgatgggcgatatg
gccggccgcctcgccgccggcccgtgggaaggccccgcgcgtgccatcatgaccacggac
acctttccgaagctcgccaccgcgcaggtgcccttcggcaacaccacggtcacgatcgct
ggcatcgccaagggcgcgggcatgatcgcccccgacatggcgaccatgctctccttcgtc
ttcaccgatgcgcccatcgcggcgccggtgctccagaagctgctctccaagctggtggtg
aacagcttcaatgccgtgaccgtggatggcgacacctccacctccgatacgctgctcctg
ttcgccaccggtgcggcgaaggaagtcggcgcgccggccgtgaaggacagtgccgatccg
gtgctgcgtcccttccgcaaggcgctgaaagcggttctcaatgatctggccgagcaggtc
gcccgcgacggcgaaggcgcgcgcaagctgatccgcgtgcacgtgtcgggcgccgtctcc
aagtcgtccgcccgccgcatcgccttctccattgccaattcgccgctggtgaagacggcg
gtcgccggcgaggacgccaactggggccgcgtggtgatggccgtgggcaaggccggcgag
cctgccgaccgtgaccgcctcgccatctccttcggcgacatccgcgtggcggcggagggc
gcgcgcgacccgtcctatgacgagcaggtggtctccgactacatgaagggcgatgtcatc
gacatccgcgtggacctcggcctcggcaagggggcggatcgcgtcctgacctgcgatctg
accaaggaatacgtggccatcaacggcgattaccgctcgtga

DBGET integrated database retrieval system