KEGG   Azorhizobium caulinodans: AZC_0315Help
Entry
AZC_0315          CDS       T00609                                 

Definition
(GenBank) NTP pyrophosphohydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
azc  Azorhizobium caulinodans
Brite
KEGG Orthology (KO) [BR:azc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:azc03400]
    AZC_0315
Enzymes [BR:azc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     AZC_0315
DNA repair and recombination proteins [BR:azc03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    AZC_0315
 Prokaryotic Type
    AZC_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4 NUDIX_2
Motif
Other DBs
NCBI-ProteinID: BAF86313
RhizoBase: AZC_0315
UniProt: A8IJJ5
LinkDB All DBs
Position
364522..364926
Genome map
AA seq 134 aa AA seqDB search
MKITLVAACALVDADNRVLVAQRPEGKALAGLWEFPGGKVEPGERPEACLIRELHEELGI
TVKEACLAPLTFASHGYETFHLLMPLWICRRWEGQVIAREHKALKWLRAGKLRDIPMPPA
DEPLIPPLIDLLGP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcacgctcgtcgccgcctgcgcgctggtggatgccgacaaccgggtgctggtg
gcccagcgcccggaaggcaaggcgctggccggcctctgggagttccccggcggcaaggtg
gagcccggcgagcggcccgaagcctgcctcatccgggaattgcatgaggaactcggcatc
acggtgaaggaggcgtgccttgcgcccctcacctttgccagccacggctatgagaccttc
catctgctgatgccgctgtggatctgccgccgttgggaagggcaggtcatcgctcgtgag
cacaaggcgctgaagtggctgcgcgcaggcaagctgcgcgacatccccatgccgccggcg
gacgaaccgctcattccgccgctgatcgaccttctcggtccctga

DBGET integrated database retrieval system