KEGG   Azorhizobium caulinodans: AZC_1917Help
Entry
AZC_1917          CDS       T00609                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00010  Glycolysis / Gluconeogenesis
azc00620  Pyruvate metabolism
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_1917
   00620 Pyruvate metabolism
    AZC_1917
Enzymes [BR:azc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AZC_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: BAF87915
RhizoBase: AZC_1917
UniProt: A8I2Q5
LinkDB All DBs
Position
complement(2213933..2215450)
Genome map
AA seq 505 aa AA seqDB search
MNKPEFARATKVPFAPRYDNFIGGQYVPPKSGRYFDNSSPVNGRVLCEIARSDAADVEAA
LDAAHRAKDAWGRTSAAERARLLLRIADVMEDNLDTLALAETWDNGKPIRETTAADIPLA
IDHFRYFAGVVRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALAA
GNCVVLKPAEQTPASIHVLIGLIADILPPGVLNVVNGFGLEAGKPLASSPRIAKIAFTGE
TSTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIHESIYDRFMEKALKRVAAITQGDPLDPATMIGAQASGEQMEKILAYLDIGKK
EGAEVLIGGARNELPGDLAGGFYVQPTVFKGTNKMRVFQEEIFGPVVSVATFKDDEEALA
IANDTLYGLGAGIWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggaattcgcccgcgccaccaaggtgcccttcgccccgcgctacgacaat
ttcatcggcgggcagtatgtgccgccgaagtcggggcgctacttcgacaacagctcgccg
gtgaacggccgcgtgctctgcgagatcgcccgctcggacgcggccgacgtggaagccgcg
ctcgatgccgcccaccgcgccaaggacgcctggggccgcaccagtgccgccgagcgtgcc
cgcctgctgctgcgcatcgcggacgtgatggaggacaatctcgacacgctggcgctcgcc
gagacctgggataacggcaagcccatccgcgagaccaccgccgccgacattccgctcgcc
atcgaccacttccgctatttcgccggcgtcgtccgcgcacaggaaggcggcatctcggag
atcgaccacgacaccgtggcctatcatttccacgagccgctcggcgtggtcggccagatc
attccgtggaatttccccatcctcatggcggtctggaagctcgcccccgcgctcgccgcc
ggcaattgcgtggtgctgaagccggccgagcagacgcccgcctccattcacgtcctgatc
ggccttatcgcggacatcctgccccccggcgtgctgaacgtggtcaacggcttcggcctc
gaggccggaaagccgctcgcctccagcccccgcatcgccaagatcgccttcaccggcgag
acctccacgggccggctgatcatgcagtacgccagccagaacctcattcccgtgacgctg
gagctcggcggcaagtcgccgaacatcttcttcaaggacgtggcggccgaggacgacgat
ttcctggacaaggccatcgaaggtttcgtcatgttcgcgctcaatcagggcgaggtctgc
acctgccccagccgcgcgctcatccatgagagcatctatgaccgcttcatggagaaggcc
ctgaagcgcgtcgccgccatcacgcagggcgatccgctcgacccggcgaccatgatcggc
gcgcaggcctccggcgagcagatggagaagatcctcgcctatctcgacatcggcaagaag
gaaggcgccgaggtcctgatcggcggcgcgcgcaacgaactgcccggagatctggccggc
ggcttctatgtgcagcccaccgtcttcaagggcaccaacaagatgcgcgtcttccaggag
gagatcttcggccccgtggtgtcggtggccaccttcaaggacgacgaggaagcgctcgcg
atcgccaacgacacgctctacggcctcggcgccggcatctggacgcgggacggaacgcga
gcctatcgcttcggccgcgccattcaggccggccgcgtctggaccaactgctaccacgcc
tatccggcccacgcggccttcggcggctacaagcagtcgggtatcggccgtgagacgcac
aagatgatgctggaccattaccagcagaccaagaacatgctggtgagctattccccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system