KEGG   Azorhizobium caulinodans: AZC_2847Help
Entry
AZC_2847          CDS       T00609                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00970  Aminoacyl-tRNA biosynthesis
azc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AZC_2847
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:azc03029]
    AZC_2847
Enzymes [BR:azc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AZC_2847
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AZC_2847
Mitochondrial biogenesis [BR:azc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AZC_2847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF5538
Motif
Other DBs
NCBI-ProteinID: BAF88845
RhizoBase: AZC_2847
UniProt: A8ICV0
LinkDB All DBs
Position
3240630..3242108
Genome map
AA seq 492 aa AA seqDB search
MTAHVRPTDAKKLIKGATGNWEVVIGMEIHAQVSSNAKLFSGASTAFGGPPNDHVSLVDA
AMPGMLPVINKECVAQAVRTGLGLRAQINLRSTFDRKNYFYPDLPQGYQISQYKSPIVGE
GEVIVDLLDGESFVVGIERLHLEQDAGKSIHDLSPTLSFVDLNRSGVALMEIVSRPDLRS
SEEARAYVTKLRSILRYLGTCDGDMEKGNLRADVNVSVRRPGEPLGTRCEIKNVNSIRFI
GQAIEVEARRQIEILEDGGVIDQETRLFDPNKGETRSMRSKEEAHDYRYFPDPDLLPLVL
HADFVEELKSHLPELPDEKKARFIADYGLSPYDASVLVAERDTADYFEQVAKGRDGKAAA
NFVINELFGRLNKDGKDVITSPVSPAQVAAIVDLIGEGVISSKIAKDLFEIVYTEGGDPR
VLVEERGLKQVTDTGAIEKVVDEIIAANPDKVAQVQAKPTMLGWFVGQAMKASGGKANPQ
ALNDILKRKLGI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccacgtccgaccgaccgacgccaagaagctcatcaagggcgccaccggcaat
tgggaagtggtgattggcatggaaatccatgcccaggtctcgtccaacgcgaagctgttc
tccggcgcctccaccgccttcggcggcccgccgaacgaccatgtgtcgctggtggacgcg
gccatgccgggcatgctgccggtcatcaacaaggaatgcgtggcgcaggcggtgcgcacc
ggcctcggtctccgggcgcagatcaacctgcgctccaccttcgaccgcaagaactacttc
tatccggacctgccgcagggctaccagatcagccagtacaagagccccatcgtgggtgaa
ggcgaggtgatcgtggacctgctggacggcgagagcttcgtcgtcggcatcgagcgcctg
catctggagcaggatgccggcaagtctatccacgacctgtcccccaccctctccttcgtg
gacctcaaccgctccggcgtggccctcatggagatcgtgtcccgccccgacctgcgctcg
tcggaggaggcccgcgcctatgtgaccaagctgcgctccatcctgcgctatctcggcacc
tgcgacggcgacatggagaagggcaacctgcgcgccgacgtgaacgtctccgtgcgccgc
cccggcgagccgctgggcacgcgctgcgagatcaagaacgtcaattccatccgcttcatc
ggccaggccatcgaggtggaggcccggcgccagatcgagatcctggaggatggcggcgtc
atcgatcaggaaacccgcctgttcgaccccaacaagggcgagacgcgctccatgcgctcc
aaggaagaggcgcacgattatcgctacttccccgatccggacctgctgcccctcgtgctg
catgccgatttcgtggaggagttgaagtcgcaccttcccgagctgccggacgagaagaag
gcgcgcttcatcgccgactacggcctcagcccctatgacgcgagcgtgctggtggccgag
cgcgacacggcggactatttcgagcaggtggccaagggccgcgacggcaaggcggcggcg
aacttcgtcatcaacgagctgttcggccgcctgaacaaggacggcaaggacgtcatcacc
tcgcccgtctccccggcgcaggtggccgccatcgtcgatctcatcggcgagggcgtcatc
tcctccaagatcgccaaggacctgttcgagatcgtctatacggaaggcggcgatccgcgc
gtgctcgtggaggagcgcggcctgaagcaggtgacggacaccggcgccatcgaaaaggtg
gtggatgagatcatcgccgccaatcccgacaaggtggcgcaggtgcaggccaagcccacc
atgctgggctggttcgtcggccaggccatgaaggcctccggcggcaaggccaacccgcag
gccctcaacgacatcctgaagcgcaagctcggcatctga

DBGET integrated database retrieval system