KEGG   Azorhizobium caulinodans: AZC_3556Help
Entry
AZC_3556          CDS       T00609                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AZC_3556
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azc02000]
    AZC_3556
Enzymes [BR:azc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AZC_3556
Transporters [BR:azc02000]
 Other Transporters
  Pores ion channels [TC:1]
   AZC_3556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: BAF89554
RhizoBase: AZC_3556
UniProt: A8IEZ7
LinkDB All DBs
Position
4083947..4084549
Genome map
AA seq 200 aa AA seqDB search
MKLFWSPRTRAFRTLWLLEETGAPYELVRVDLNGGDGIDDAELLAANPMGKVPALVDRGI
PIAESGAIALYVADRFPEAGLSPPLGDPERGPFLHWMIFVASCVEPALVQKMKGVELPTS
AAGWGSFEKVMSVLDARLSTHPFLVGERFTAADTLLATDLGYFIQVFKMLEPRPSFTAYL
ARCAERPAFVRARAIEAEYA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcttctggtcgcccagaacccgcgccttccgcacgctctggctgctggaggag
acgggcgctccctatgaactggtccgcgtggacctgaatggcggcgacggcatcgacgat
gccgagttgctcgccgccaatcccatgggcaaggtgcccgcgctggtggatcgtggcatc
cccatcgccgagagcggcgccatcgcgctctacgtggccgaccgttttcccgaggccggc
ctttccccgccgctgggcgatcccgagcgcggccccttcctgcactggatgatcttcgtc
gcctcctgcgtggagccggcgctggtgcagaagatgaagggcgtggaactgcccaccagc
gccgccggctggggcagcttcgagaaggtgatgtcggtgctggacgcccgcctcagcacc
catcccttcctggtgggcgagcggttcacggccgccgacacgctgctcgccacggacctc
ggctatttcatccaggtcttcaagatgctggagccgcgcccctccttcaccgcctatctg
gcgcgctgcgccgaacgcccggccttcgtccgcgcccgcgccatcgaggcggaatacgcc
tga

DBGET integrated database retrieval system