KEGG   Azorhizobium caulinodans: AZC_4644Help
Entry
AZC_4644          CDS       T00609                                 

Definition
(GenBank) enoyl-acyl carrier protein reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00061  Fatty acid biosynthesis
azc00780  Biotin metabolism
azc01100  Metabolic pathways
azc01130  Biosynthesis of antibiotics
azc01212  Fatty acid metabolism
Module
azc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AZC_4644
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AZC_4644
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AZC_4644
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:azc01004]
    AZC_4644
Enzymes [BR:azc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AZC_4644
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AZC_4644
Lipid biosynthesis proteins [BR:azc01004]
 Fatty acid synthase
  Component type
   AZC_4644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAF90642
RhizoBase: AZC_4644
UniProt: A8HZY9
LinkDB All DBs
Position
5282170..5283027
Genome map
AA seq 285 aa AA seqDB search
MHDLMKGKRGLVMGVANDHSIAWGIAKSLAGQGAELAFTYQGEAMAKRVRPLAESLGAKV
MMPCDVEDLASVDALFDALRKEWGSLDFVVHAVAFSDKSELKGRYADTTRDNFSRTMLIS
CFSFTEIAKRAAELMTNGGSLITLTYGGATRVMPNYNVMGVAKAALEASVRYLAADFGPQ
GIRVNAISAGPVRTLAGAGIADARLMFNYQKRHAPLRRTVSLEEVGGSALYLLSELSGGV
TGEVHFVDSGYNIMSMPHPDVLKTQEDAEAKMAAETATVPPKAAE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacctgatgaagggcaagcgcggcctggtgatgggcgtggccaacgaccactcc
atcgcgtgggggatcgcgaagagcctcgctggtcagggcgcagagcttgctttcacctat
cagggcgaggccatggccaagcgggtgcgcccgctggccgaaagcctcggcgcgaaggtg
atgatgccctgcgacgtggaagacctcgccagcgtcgacgctctgttcgatgcgctgcgc
aaggaatggggttcgctggatttcgtggtccacgccgtggccttctccgacaagtcggag
ctgaagggccgttacgcggacacgacgcgggacaatttctcccgcaccatgctgatctcc
tgcttctccttcacggagatcgccaagcgggcggccgagctgatgaccaacggcggctcg
ctgatcaccctgacctacggcggcgccacccgcgtgatgccgaactacaatgtgatgggc
gtggccaaggcggcgctggaagccagcgtgcgctacctcgccgccgacttcggtccccag
ggcatccgcgtcaacgccatctcggcgggcccggtgcggacccttgccggtgccggcatc
gccgacgcccggctgatgttcaactatcagaagcgccacgccccgctccgccgcacggtc
tcgctggaagaagtgggcggttcggccctctatctgctctccgagctgtcgggcggcgtg
accggcgaagtgcacttcgtggacagcggctacaacatcatgtccatgccgcacccggac
gtgctgaagacgcaggaagacgcggaagcgaagatggcggccgagaccgccaccgtgccg
ccgaaggccgccgagtaa

DBGET integrated database retrieval system