KEGG   Azorhizobium caulinodans: AZC_4669Help
Entry
AZC_4669          CDS       T00609                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00620  Pyruvate metabolism
azc00680  Methane metabolism
azc01100  Metabolic pathways
azc01120  Microbial metabolism in diverse environments
azc01200  Carbon metabolism
Module
azc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZC_4669
  09102 Energy metabolism
   00680 Methane metabolism
    AZC_4669
Enzymes [BR:azc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AZC_4669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAF90667
RhizoBase: AZC_4669
UniProt: A8I060
LinkDB All DBs
Position
5311444..5314239
Genome map
AA seq 931 aa AA seqDB search
MTSAVWAVVSEQEAGGPDKDQPLRDDIRLLGRILGDTVREQEGDAIYELVETIRQTSIRF
HRDADEAARQELNALLESMTPEVAVQIIRAFSYFSHLANIAEDQHHSRRNRAHAVAGSAP
RPGTLANALARAEKAGIGAAELRAFFDAALVSPVLTAHPTEVRRKSTMNREMEIADLLDL
KERLQATPQEAREQDEKLRRAVLTLWQTALLRKFKLTVLDEVQNGLSYYDYTFLAEVPRL
LCALEDHLAEQEGGEPGAELPPFLRIGSWIGGDRDGNPFVTADVLRETVRQHRDRVMAFY
LEQVGLLVTELSLAKRLVAVSEDLTALAERSGDRAPEHREEPYRLALVGIHNRLKATVAA
QKAADDGKTMGAAEDGHLPYPDAAAFRADLDILYRSLMANGSAILARGRLRHVRRAVDSF
GFHLASLDLRQNSDVHERTVADLLEQAAPGTNYHALDEEARIAVLRAELTNPRPLASPFL
SYTEETRSELAILRTAAEAHARLGKTVIPNAIISKAEGISDMLELALLLKEVGLVSATGE
SAINVIPLFETIGDLQACGPVMDRLLALPEYRALVDSRGGEQEVMLGYSDSNKDGGFVSS
GWELYKAEIALIEVFARHKVKLRLFHGRGGSVGRGGGPSYDAILAQPAGAVSGQIRITEQ
GEIISSKYSNPENGRRNLEILVSATLESTLLEAEQASPRPEFLAAMEELSKTAFTAYRSL
VYETPGFEDYFWSSTVISEIATLNIGSRPASRNKTRAIEALRAIPWVFSWSQCRLMLPGW
YGFGTAIAAFVEARPVDGIAFLQSMYREWPFFRTLLSNMDMVLSKSSLAVASRYAELVPD
EELRTRIFSRISAEYQSAITSLLAIMGQKKLLEANPLLDRSIRNRFPYLDPLNHIQVELL
KLHRSDAGSDHVLHGIQLTINGISAGLRNSG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgcggtctgggccgtggtgagcgagcaggaagccggcggtccggacaaggac
cagccgttgcgggacgacatccggctgctcggccgcatcctcggcgatacggtgcgggag
caggagggcgatgccatctatgagctggtggagaccatccgccagacctccatccgcttc
caccgcgatgccgacgaggccgcgcgccaggaactgaacgcgctgctggagagcatgacg
ccggaggtggcggtgcagatcatccgcgccttctcctatttctcccatctcgccaacatc
gccgaggaccagcaccacagccggcgcaaccgcgcccatgcggtggccggctcggcgccc
cgcccgggcaccctcgccaatgcgctcgcccgcgccgagaaggccggcatcggcgccgcc
gagctgcgcgccttcttcgacgcggcgctggtgagcccggtgctcaccgcccacccgacc
gaagtgcgccgcaagagcacgatgaaccgcgagatggagatcgccgatctcctggatctc
aaggagcgccttcaggcgaccccgcaggaagcgcgcgagcaggacgagaagctgcgccgg
gcggtgctgacgctgtggcagaccgccctgctgcgcaagttcaagctcaccgtcctggac
gaggtgcagaacggcctctcctattacgactacaccttcctggccgaggtgccgcgcctc
ctctgcgcgctggaagaccatctggcggaacaggaaggcggcgagccgggcgcggagctg
ccgccgttcctgcgcatcggcagctggatcggcggcgaccgcgacggcaatcccttcgtc
accgccgacgtgctgcgcgagaccgtgcgccagcaccgcgaccgggtgatggctttctat
ctggagcaggtcggcctgctggtcaccgagctgtcgctggccaagcgcctcgttgccgtt
tccgaagacctgacagcgctggccgaacgctcgggcgaccgggcgccggagcatcgggag
gagccctatcgcctcgcactggtgggcatccacaaccgcctcaaggcgacggtggcggcg
cagaaggctgccgacgacggcaagaccatgggcgcggccgaggacggccacctgccctat
ccggacgccgccgccttccgggccgacctcgacatcctctatcgctcgctgatggccaac
ggctcggccatcctcgcccgcggccgcctgcgccatgtccgccgggcggtggacagtttc
ggcttccacctcgccagcctcgacctgcggcagaattccgacgtgcacgagcgcacggtg
gcggacctgctggaacaggcggcgccgggcaccaactatcacgccctcgacgaggaagcc
cgcatcgccgtgctgcgggcggaactgaccaatccgcgtcccctggcctcgccgttcctg
agctatacggaggagacgcgatccgaactcgccatcctgcgcacggctgccgaagcccac
gcccggctcggcaagacggtcattcccaatgccatcatctccaaggccgagggcatctcg
gacatgctggagctggcgctgctcctgaaggaggtggggctcgtctccgccaccggcgag
agcgccatcaacgtcatcccgttgttcgagaccatcggcgaccttcaggcctgcggcccg
gtcatggaccgcctgctcgccctgccggaatatcgcgcgctggtggacagccggggcggc
gagcaggaggtgatgctcggctattccgacagcaacaaggacggcggcttcgtctcctcc
ggctgggagctctataaggccgagatcgccctcatcgaggtgttcgcccgccacaaggtg
aagctgcgcctgttccacggccggggcggctcggtgggccggggcggcggcccgtcctat
gacgccatcctcgcccagccggcgggggcggtgagcgggcagatccgcatcaccgagcag
ggggagatcatctcctccaaatattccaaccccgagaacggccggcgcaacctcgagatc
ctcgtctccgcgacgctggaatccactttgctggaagccgagcaggcgagcccccgcccg
gaattcctcgccgccatggaggaactgtccaagaccgcgtttacggcctatcgctcgctc
gtctacgagaccccgggcttcgaggactatttctggtcctcgaccgtcatcagcgagatc
gcgacgctgaacatcggctcgcgcccggcctcgcgcaacaagacccgcgccatcgaggcg
ctgcgggcgatcccctgggtgttctcctggtcgcagtgccggctgatgctgcccggctgg
tacggcttcggcacggcgatcgccgccttcgtggaggcccgcccggtggacggcatcgcc
ttcctccagtccatgtaccgggagtggcccttctttcgtacgctcctgtccaacatggac
atggtgctctccaagagcagcctcgccgtcgcctcgcgctatgccgagctggtgccggac
gaggagctgcgcacgcgcatcttcagccgcatctccgcggaatatcagagcgctatcacc
agcctgctcgccatcatggggcagaagaagctgctggaggccaacccgctgctggaccgc
tccatccgcaaccgcttcccctatcttgacccgctcaaccacatccaggtcgagctcctg
aagctgcaccggagcgatgccggcagcgaccatgtgctgcacggcatccagctcaccatc
aacggcatctccgcagggttgaggaacagcggctga

DBGET integrated database retrieval system