KEGG   Azoarcus sp. DN11: CDA09_00560Help
Entry
CDA09_00560       CDS       T05691                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00970  Aminoacyl-tRNA biosynthesis
azd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CDA09_00560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:azd03029]
    CDA09_00560
Enzymes [BR:azd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CDA09_00560
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CDA09_00560
Mitochondrial biogenesis [BR:azd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CDA09_00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase YcaO
Motif
Other DBs
NCBI-ProteinID: AYH41888
UniProt: A0A3S7UA72
LinkDB All DBs
Position
complement(117255..118718)
Genome map
AA seq 487 aa AA seqDB search
MIHASLTELRAALDAKKISSVELATLFLDRIAAHNPTLNAFITVDRDGAIAAARAADARI
AAGQAGPLTGIPLAHKDVFCTEGLLTTCGSKMLSNFVSPYDAHVVALLKAAGAVTLGKTN
MDEFAMGSSNENSHYGPVRNPWDTTRIPGGSSGGSAAAVAARLAPIATGTDTGGSVRQPA
CHTGITGIKPTYGVVSRYGMIAYASSLDQGGAFGASAADCAQLLTAMAGFDARDSTSLDR
PAEDYTRELAAPANEKPLAGLRIGLPREFFAEGMADDVRAAVDTALDQYRKLGATTVDVS
LPNAKLAIPAYYVIAPAEASSNLSRFDGVRYGHRAAEYRDLAEMYAKSRAEGFGAEVKRR
ILVGTYVLSHGYYDAYYLQAQKLRRLIAQDFQAAFRDCDVIAGPTSPTTAWAISEKTDDP
VQMYLSDIYTIAVNLAGLPGLSHPCGFGAGKLPVGLQLIGDYFGEARLLATVHQYQQATD
WHLRRPG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgccagcctcaccgaactgcgcgccgcactcgacgcgaagaagatatccagc
gtcgagctcgcgacgctcttcctcgaccgcatcgccgcgcacaacccgacgctcaacgcc
ttcatcaccgtcgaccgcgacggcgcgatcgcggccgcccgggccgccgacgcgcgcatc
gccgccggccaagccggcccgctcactggcatcccgctcgcccacaaggacgtgttctgc
accgaaggcctgctcacgacctgcggctcgaagatgctgtcgaacttcgtcagcccctac
gacgcccacgtcgtcgcgctactgaaggccgccggcgccgtcacgctcggcaagaccaac
atggacgagttcgcgatgggctcgtccaacgagaactcgcattacggcccggtgcgcaac
ccctgggacaccacgcgcatccccggcggctcctcgggcggctcggccgccgcggtcgcc
gcgcgcctcgcgccgatcgccaccggcaccgacaccggcggctctgtgcgccagcccgcg
tgccacaccggcatcaccggcatcaagccgacctacggcgtcgtcagccgctacggcatg
atcgcgtacgcgagctcgctcgaccagggcggcgccttcggcgcgtccgcggccgactgc
gcacagctgctgaccgcgatggcgggcttcgacgcgcgcgactcgaccagcctcgaccgc
cccgccgaagactacacgcgcgagctcgccgcaccggcgaacgagaaaccgctcgccggc
ctgcgcatcggcctgccgcgcgaattcttcgccgaaggcatggccgacgacgtacgtgcc
gcggtcgacacggccctcgaccagtaccgcaagctcggggcgaccaccgtcgacgtgagc
ctgccgaacgcgaagctcgcgatccccgcctactacgtgatcgcgcccgccgaagcctcc
agcaacctgtcgcgcttcgacggcgtgcgctacggccaccgcgccgccgagtaccgcgac
ctcgccgagatgtacgcgaagagccgcgccgaaggcttcggcgccgaagtgaagcgccgc
atcctcgtcggcacctacgtgctatcgcacggttactacgacgcctactacctgcaggcg
cagaagctgcgccgcctcatcgcgcaggacttccaggccgcgttcagggattgcgacgtg
atcgccggccccaccagccccaccaccgcgtgggcgatcagcgagaagaccgacgacccg
gtgcagatgtacctgtcggacatctacaccatcgccgtgaacctcgccggcctgccgggc
ctgtcgcacccctgcggcttcggtgccggcaagctcccggtcggcctgcagctcatcggc
gactacttcggtgaagcgcgcctgctcgccaccgtgcaccagtaccagcaggctaccgac
tggcacctgcgccgtccgggctga

DBGET integrated database retrieval system