KEGG   Azoarcus sp. DN11: CDA09_01235
Entry
CDA09_01235       CDS       T05691                                 

Definition
(GenBank) ethanolamine utilization protein
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03430  Mismatch repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_01235
   03430 Mismatch repair
    CDA09_01235
   03440 Homologous recombination
    CDA09_01235
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_01235
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_01235
Enzymes [BR:azd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CDA09_01235
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CDA09_01235
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CDA09_01235
SSDB
Motif
Pfam: RNase_T GIY-YIG Nucleic_acid_bd
Other DBs
NCBI-ProteinID: AYH42017
UniProt: A0A3Q8HQX3
LinkDB
Position
278243..279646
AA seq 467 aa
MSLPDSLVLIDVETTGANPLRDRVTEIAVLRIERGELVDRWETLVNPECPIPPLIQRLVG
ITDAMVAGAPTFAALADEVRARLGGAVFVAHNARFDYGFIRSEFARIEQTFDAPVLCTVK
LSRALYPEHHRHGLDALIERHGFTCGARHRAMGDTEVLWQFARLVTDSFAPDVLARAVER
AMKRPARAVELPEGVLEGLPESPGLYYLYGDNDQLLYIGRSPCLRARVMEHFAPGVKGKD
AELAKRVRRVDWEESAGELTATLREMELLHRRCPPYNRVAGSADVFGLQYVPGRKRPPIL
QRVALAGSDPAAWGDVHGTFRTKKEADNLLRELAQAYQLCLRRLGLESGNSGPCSAHLAK
RCAGVCAGKESFAAHDERLLGALGAVRLRPWPWPGAVMIAERCPHSGSEAWHVVDRWCLL
GTADSPLALDALRAALPPRRFDLDIYRTLVRWLAADGHRDAVTPLLS
NT seq 1404 nt   +upstreamnt  +downstreamnt
gtgtcgctgcctgactcactggtcctgatcgacgtcgaaaccaccggcgcgaatccgttg
cgcgaccgcgtgacggagattgccgtgctgcgcatcgagcgcggcgagctggtcgatcgc
tgggaaacgctggtcaatcccgaatgcccgatcccgccgctgatccagcggctggtcggc
atcaccgacgcgatggtcgccggtgcgccgactttcgcggcgctcgccgacgaggtgcgt
gcccggctgggcggcgcggtgttcgtcgcgcacaacgcgcgcttcgactacggcttcatc
cgcagcgagtttgcgcgcatcgagcagactttcgacgccccggtgctgtgcaccgtgaag
ttgtcgcgcgcgctgtatcccgagcatcaccgccacggcctcgacgcgctgatcgagcgc
cacggcttcacctgcggcgcccgccaccgtgcgatgggcgacaccgaggtgctgtggcag
tttgcccgcctcgtcaccgactcgttcgcgcccgacgtgctcgcgcgcgcggtcgagcgc
gcgatgaagcgcccggcgcgcgcggtcgagctgcccgagggcgtgctcgaaggcctcccc
gagtcgcccggcctgtactacctgtacggcgacaacgaccagctcctctacatcggccgc
agcccctgcctgcgcgcgcgcgtgatggaacacttcgcgcccggcgtgaagggcaaggac
gcggaactcgccaagcgcgtgcgccgcgtcgactgggaggaaagcgccggcgagctgacg
gcgacgctgcgcgagatggaactgttgcaccggcgctgcccgccgtacaaccgcgtcgcg
ggcagcgcggacgtcttcggcctgcagtacgtgccggggcgcaagcgtccccccatcctg
cagcgtgtcgcgctggcgggcagcgatccggcggcgtggggcgacgtgcacggcacgttc
cgcaccaagaaggaagccgacaacctgctgcgcgaactggcgcaggcctatcagctatgc
ttgcgccgcctcgggctggagtcgggcaacagcggcccgtgctcggcgcacctcgcgaag
cgctgcgccggcgtgtgtgccggcaaggaaagcttcgcggcgcacgacgagcgcctgctc
ggcgcactcggggccgtgcggctgcgcccctggccgtggccgggcgcggtgatgatcgcg
gaacgctgtccccacagcggcagcgaggcctggcacgtggtcgaccgctggtgcctgctc
ggcaccgccgacagtcccctggcgctggacgcgttgcgcgcggcgctgccgccgcgccgc
ttcgatctcgacatctaccgcacgctggtgcgctggctggccgcggacggtcaccgcgac
gccgtcacgccgctcctgtcctga

KEGG   Azoarcus sp. DN11: CDA09_08950
Entry
CDA09_08950       CDS       T05691                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03430  Mismatch repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_08950
   03430 Mismatch repair
    CDA09_08950
   03440 Homologous recombination
    CDA09_08950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_08950
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_08950
Enzymes [BR:azd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CDA09_08950
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CDA09_08950
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CDA09_08950
SSDB
Motif
Pfam: RNase_T DNA_pol_A_exo1 RNase_H_2 OPA3
Other DBs
NCBI-ProteinID: AYH43509
UniProt: A0A3S7UER8
LinkDB
Position
1944527..1946695
AA seq 722 aa
MTARARFILAVCILALLMTGPFVVTAGLVWLETGAADRGRLIDVVVPHLPLGALMTIVGF
ALGMVVVRNLFRHYVQGLLRMEEHLKLMLGANREFRVKPEGPPEVQALAHAVNTLAQQRD
ALMQDVEAQIAHAKHSVEEEKNRLAALMSELTQSVVVCNLDGRILLYNHRARQQFRALSD
APAVAGGGELIGLGRSIYAVFERNLINHALESIEHGLRRSAVQPVANFVTTTRAGQLLRA
QMAPVLAVGQGSDSERAITGFILMLDNITRTFETESKRDQMLHTLTEGNRAALANVRAAA
EMLEYPDLQEELRERFRTVIRDEVRAMSTRLDHTANEFADSLKARWPLEEMLGADLIAAA
QRRIENVVKLPTKLEEIDESLWVKVDSFSLLQALTYLANRLSDEFEVREVRFRLSAAGRL
VHLDLIWSGQAMSTETVMSWELEPMRFADENSPLTVRDVIERHDGEMWLEREKVRHRAFF
RILLPAAMPQEQLDEVAILRGKGRPEYYDFDLFNWSDKSRALDDRLLSELTYTVFDTETT
GLNPSQGDEIIQIGATRIVNGKLLRQESFEQLVDPGRYLSPESVQIHGITHDMLRNQPTI
EAVLPAFHAFAEDTVLIAHNAAFDMRFLQMKEEATGIRFDQPVLDTLLLSAVAHPNQESH
RLEAIAERLNLPIIGRHTALGDATVTAEVFLKLIPLLAEKGIHTLRQAREAAEQSYYARV
RY
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgactgctcgcgcccgtttcatcctggcggtgtgcattctcgcgcttctcatgaccggc
cccttcgtcgtgacggcgggcctggtgtggctcgagaccggcgcggccgaccggggacgg
ctgatcgacgtggtcgtgccgcatcttccgctcggtgcgttgatgaccatcgtcggcttc
gcgctcggcatggtggtcgtgcgcaacctgttccggcattacgtgcaggggctgctgcgc
atggaggagcatctcaagctgatgctcggcgccaaccgcgaattccgcgtcaagccggag
gggccgcccgaggtgcaggcgctggcgcatgcggtcaacacgctggcgcagcagcgcgac
gcgctgatgcaggacgtcgaggcgcagatcgcgcatgcgaagcattcggtcgaggaggaa
aaaaaccgccttgccgcgctgatgtcggagctcacgcagagcgtcgtcgtgtgcaatctc
gacggtcgcatcctgctttacaaccaccgtgcgcgtcagcagttccgcgcgctgtccgac
gcgccggccgtcgccggcggcggcgagctgatcgggctcgggcgctccatctacgcggtg
ttcgagcgcaacctcatcaaccatgcgcttgagagcatcgagcacggcctgcgccgcagc
gcggtccagccggtcgccaacttcgtcaccacgacgcgtgcgggccagttgctgcgtgcg
cagatggcgccggtgctggccgtggggcaggggagcgacagcgagcgcgcgatcacgggc
ttcatcctgatgctcgacaacatcacgcgcaccttcgaaaccgaatcgaagcgcgaccag
atgctgcacacgctcaccgaaggcaaccgggcggcgcttgccaacgtgcgtgcggcggcc
gagatgctcgaatacccggacctgcaggaggagctgcgcgagcgcttccgcaccgtgatc
cgggacgaagtgcgggcgatgagcacccgcctcgaccatacggcaaacgagttcgccgat
tcgctgaaggcgcgctggccgctcgaggaaatgctcggggccgacctcatcgccgcggcg
cagcgccgcatcgagaacgtcgtcaagctgcccaccaagctggaggagatcgacgagtcg
ctgtgggtgaaggtcgacagcttctcgctgctgcaggcgctgacttaccttgccaaccgc
ctgtccgacgagttcgaggtgcgcgaggtgcgtttccgtctgagcgccgcgggccggctg
gtccacctcgatctcatctggtccggccaggcgatgagcaccgagacggtgatgagctgg
gaactggagccgatgcgctttgcggatgagaacagtccgctcacggtgcgcgatgtgatc
gagcgccacgatggcgagatgtggctcgagcgcgagaaagtgcgccaccgcgcgttcttc
cgcatcctgttgccggccgcgatgccgcaggaacagctcgacgaggtggccatcctgcgc
ggaaaaggccggccggagtattacgatttcgacctcttcaactggtccgacaagtcgcgt
gcgctcgacgaccgcctgctcagcgaactgacctatacagtgttcgacacggaaacgacg
gggctgaatccgtcccagggtgacgagatcatccagatcggcgcgacgcgcatcgtcaac
ggcaagctgctgcgccaggagtcgttcgagcaactcgtcgatcccggccgctacctgtcg
cccgagtcggtgcaaatccacggcatcacccacgacatgctcaggaaccagccgacgatc
gaggcggtcctgccggccttccatgcgtttgccgaggacaccgtgctgatcgcgcacaat
gctgcgttcgacatgcgcttcctgcagatgaaggaggaggcgacgggcatccgcttcgac
cagccggtgctcgatacgctgctgctgtcggccgtcgcccatccgaaccaggaatcacac
cggctcgaagcgatcgccgaacggctgaacctgcccatcatcggccggcacacggcgctg
ggcgacgcgaccgtcacggcagaggtcttcctgaagctgatcccgttgctggccgaaaag
ggtatccatacgctgcgccaggcgcgcgaggccgcggaacagtcctactacgcgcgggtg
aggtattga

KEGG   Azoarcus sp. DN11: CDA09_11925
Entry
CDA09_11925       CDS       T05691                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03430  Mismatch repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_11925
   03430 Mismatch repair
    CDA09_11925
   03440 Homologous recombination
    CDA09_11925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_11925
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_11925
Enzymes [BR:azd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CDA09_11925
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CDA09_11925
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CDA09_11925
SSDB
Motif
Pfam: RNase_T DNA_pol_A_exo1 RNase_H_2 vATP-synt_AC39
Other DBs
NCBI-ProteinID: AYH44084
UniProt: A0A3S7UGF2
LinkDB
Position
2605475..2606203
AA seq 242 aa
MRQIVLDTETTGLDWRNGDRVIEIGCVELLNRNLTGRHYHVYINPERGIDAEAIAVHGIT
EEFLADKPKFRDIADDFMDFVRDAELVIHNASFDVGFLDHELSLLRHPKLDALCAGVIDT
LRMAKEQNPGKKASLDALCDRYEIDNAARTLHGALLDAELLAEVYLAMTRGQESLMMMLD
DEPAAGSGEDGGSPVERPPLRVLRASAEELGEHDRILQDIAKANKGACLWIPPVPAEEAP
VA
NT seq 729 nt   +upstreamnt  +downstreamnt
ttgagacagattgtcctggataccgaaacgaccggcctcgactggcgcaatggcgaccgc
gtgatcgagatcggctgcgtcgaactgttgaatcgcaacctgacggggcggcactaccac
gtctacatcaaccccgaacgggggatcgatgccgaggcgatcgcggtgcacggcatcacc
gaggagttcctcgcggacaagccgaaattccgcgatatcgccgacgacttcatggatttc
gtgcgcgacgcggagctcgtgatccacaatgcgagcttcgacgtgggcttcctcgaccac
gagctgtcgctgctgcggcatccgaagctggatgcactgtgcgcgggcgtgatcgacacg
ctgcggatggccaaggagcagaatccgggcaagaaggcgtcgctcgacgcgttgtgcgat
cgctatgagatcgacaacgccgcacgcacgctgcacggggcgctgctcgacgcggagctc
ctcgccgaggtctacctggcgatgacccgcgggcaggaaagcctgatgatgatgctcgac
gacgaacctgcggcgggcagcggggaagacggcggatcgccggtcgagcggccgccgctg
cgggtgctgcgtgcgtccgccgaggaattgggcgagcacgatcgcatcctgcaggacatc
gcgaaggcgaacaagggcgcctgcctgtggattccgccggtgccggccgaggaagcgccc
gtggcctga

KEGG   Azoarcus sp. DN11: CDA09_15835
Entry
CDA09_15835       CDS       T05691                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03430  Mismatch repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_15835
   03430 Mismatch repair
    CDA09_15835
   03440 Homologous recombination
    CDA09_15835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_15835
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_15835
Enzymes [BR:azd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CDA09_15835
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CDA09_15835
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CDA09_15835
SSDB
Motif
Pfam: RNase_T RNase_H_2
Other DBs
NCBI-ProteinID: AYH44836
UniProt: A0A3Q8HU56
LinkDB
Position
3443869..3444513
AA seq 214 aa
MNWLTRLLGNSADTATLDVALRDALAKWEALPAPDLGTAHFETRYVVINTEATGLDLDKD
RLLAVAAIAVDREQLSPHDSFHAAVEPDAAAVLTSLLAFAGKGPVVVFNASFNRSLLERA
LDEHLGITPDWTWLDLHWLLPALYDEHIDRPARLADWMKAFGIETFQRHHALGDAWAIAQ
LMLAAQARARALGHNTPRTLAELEHSRRQLRRHG
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaattggctcacccggctcctcggcaacagcgcagacacggccacgctcgacgtcgcg
ctgcgcgatgccctcgcgaagtgggaagcgctgccggcgccggatctgggcaccgcccac
ttcgagacgcgctacgtggtcatcaacaccgaggccaccgggctcgatctcgacaaggat
cgcctgctcgcagtcgcggcgatcgccgtcgaccgcgaacaactgtccccgcacgacagc
tttcatgccgccgtggaaccggatgccgcggcggtactgacgagcctcctcgccttcgcg
ggcaagggcccggtcgtggtgttcaacgcgtcgttcaaccgcagcctgctcgaacgtgcg
ctcgacgagcatctcggcatcacgccggactggacctggctcgacctgcactggctcctg
ccggccctctacgacgaacacatcgaccggccggcgcgtctggccgactggatgaaggcc
ttcggcatcgagaccttccagcgccaccacgcgctgggggatgcctgggcgatcgcgcaa
ctgatgctcgccgcgcaggcacgcgcccgcgcgctcggccacaacactccacgcacgttg
gcggaactggaacacagccgccggcaattgaggcgtcacggatga

DBGET integrated database retrieval system