KEGG   Azoarcus sp. DN11: CDA09_02515
Entry
CDA09_02515       CDS       T05691                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03410  Base excision repair
azd03420  Nucleotide excision repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_02515
   03410 Base excision repair
    CDA09_02515
   03420 Nucleotide excision repair
    CDA09_02515
   03440 Homologous recombination
    CDA09_02515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_02515
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_02515
Enzymes [BR:azd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CDA09_02515
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     CDA09_02515
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     CDA09_02515
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CDA09_02515
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N DNA_pol_A_exo1 5_3_exonuc
Other DBs
NCBI-ProteinID: AYH42270
UniProt: A0A3S7UB66
LinkDB
Position
561479..564244
AA seq 921 aa
MPVLLLVDGSSYLYRAFHALPDLRTSQGEPTGAIRGVLSMLRRLESDYKAEFRACVFDAK
GKTFRDDLYPEYKSHRPPMPDDLRAQIEPLHAAVQAEGWPLLAIEGVEADDVIGTLTRQA
QERGWEVVISTGDKDLTQLVRPGVKWVNTMSEEVLDEAGVTEKFGVPPERIVDYLALVGD
AVDNVPGVEKCGPKTAVKWLTEYGTLDNLVANADKVGGKVGENLRKHLDFLPLGKKLVTV
VTDVALPLALDALPARGDDKAALRALYERFEFRGWLKDLDGPASVRNAGGSARSANAVAP
EASGAVAVVTEDPPAAPGAHRGGYVTILDRATFDAWLAKLEAAVLVAFDTETTSLDPMAA
QLVGMSFATVAGEAAYLPLAHRGPDVPAQLPLAEVLARLKPWLESDAHAKLGQNLKYDAH
VLANHGIRLAGIAHDTLLQSYVLESDKSHDMDSLAKRHLGLTTIPYTDVCGKGAKQIGFD
EVALERASEYAAEDADITLRLHETLWPQLEAVPALAALYRDIEMPAMQVLFDMERTGVLI
DDFLLAQQSEELGRRLMALEREAHELAGQPFNLASPKQLGEILFGKLGLPVVKKTATGQP
STDEEVLVQLSDDYPLPKLLLEHRGFAKLKSTYADKLPRMVNPKTGRVHTSFSQAVAVTG
RLASSEPNLQNIPIRTAEGRRIRAAFIAPRDHVIVSADYSQIELRIMAHLSGDARLLEAF
AHGEDVHRATASEVFGVTPAEVTSEQRRYSKVINFGLIYGMSAHGLAKNLGIDRAAAQGW
IDRYFARYPGVADYMERIKGEAKAKGYVETVFGRRLYLPDIRAQQVGRRQGAERAAINAP
MQGTAADLIKKAMIAVHGWLGASGLRSRLILQVHDELVLEVPRDELELMRRELPARMGGV
AELAVPLLVEVGAGNNWDEAH
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgcccgtcctgttgctcgtcgatggttccagctatctgtatcgcgccttccatgcgctg
ccggatctccgcacgtcgcagggcgagccgaccggggcgattcggggtgtgttgtcgatg
ctacgtcggctcgaaagcgactacaaggccgaattccgtgcctgcgtgttcgacgccaag
ggcaagaccttccgcgacgacctgtacccggaatacaagtcgcaccgcccgccgatgccc
gacgacctgcgcgcgcagatcgaaccgctgcacgcggcggtgcaggcggaaggctggccg
ctgctggcgatcgagggggtcgaggccgacgacgtgatcggcacgctcacgcgccaggcc
caggagcgtggctgggaggtcgtgatctcgaccggcgacaaggacctgacccagctcgtg
cgccctggcgtgaagtgggtgaacacgatgagcgaggaggtgctcgacgaggccggcgtg
acggagaaattcggcgtgccgcccgagcgcatcgtcgattatctcgcgctggtcggtgat
gccgtcgacaatgtgccgggcgtcgagaagtgcgggccgaagacggcggtgaagtggctc
accgagtacggcacgctcgacaacctcgtcgcgaacgccgacaaggtgggtggcaaggtg
ggcgagaacctgcgcaagcatctcgatttcctgccgctggggaagaagctcgtgacggta
gtgaccgacgtcgcgctgccgctggcgctcgacgcgctgcccgcgcgcggggacgacaag
gcggcgctacgcgcgctgtacgagcgcttcgagttccgcggctggctcaaggatctggac
gggccggcgtcggtgcgcaatgctgggggtagcgcccggtcggcgaacgccgttgcgccg
gaggcatcgggcgcggtcgccgtcgtgacggaggacccgcccgcggcgccgggcgcgcat
cgcggcggctacgtgacgatcctcgaccgggcgacgttcgacgcctggctggcgaaactc
gaggccgcggtgctcgtcgcgttcgacaccgagacgaccagcctcgacccgatggcggcg
cagctcgtgggcatgtccttcgcgaccgtcgcgggcgaggcggcctacctgccgctggcg
caccgcggacccgacgtgccggcgcagctgccgctcgccgaggtgctcgcgcgcctcaag
ccgtggctcgaatcggacgcccatgccaagctcggccagaacctcaagtacgacgcgcac
gtgctcgccaatcacggcatccgtctcgccggtatcgcgcacgacacgctgctgcagtcc
tacgtgctggaaagcgacaagtcgcacgacatggattcgctggcgaagcgccatctgggc
ctgacgacgattccctacaccgacgtgtgcggcaagggcgcgaaacagatcggcttcgac
gaggtcgcgctcgagcgtgcgagcgaatacgcggccgaggacgccgacatcacgctgcgc
ctgcacgagacgctgtggccgcagctcgaggcggtgccggcactggccgcgttgtaccgc
gacatcgagatgccggcgatgcaggtgctgttcgacatggaacgcaccggcgtgctgatc
gacgacttcctgctcgcgcagcagagcgaggagctcgggcggcgcctgatggcgctggag
cgcgaggcgcacgagctcgccgggcagcccttcaacctcgcctcgcccaagcagctcggc
gagatcctgttcggcaagctgggcctgccggtcgtcaagaagactgcgaccggccagccc
tccaccgacgaggaggtgctcgtccagctctccgacgactacccgctgcccaagctgctg
ctcgaacaccgcggcttcgcgaagctcaagagcacctacgcggacaagctgccgcgcatg
gtcaacccgaagaccgggcgcgtgcacacgagcttctcgcaggcggtcgcggtcaccggg
cggctggcgagctcggagccgaacctgcagaacatcccgatccgcaccgccgaagggcgg
cgcatccgcgcggccttcatcgcgccgcgcgaccacgtgatcgtgtcggccgactattcg
cagatcgagctgcgcatcatggcgcacctgtcgggcgacgcgcgcctgctggaagccttc
gcgcacggcgaggacgtgcatcgcgcgaccgcctcggaagtgttcggcgtcacgccggcg
gaagtcaccagcgagcagcgccgctattcgaaggtcatcaatttcggcctcatctacggc
atgagcgcgcacgggctggcgaagaacctcggcatcgaccgcgccgccgcgcagggctgg
atcgaccgctatttcgcgcgttatccgggcgtcgccgactacatggagcgcatcaagggc
gaggccaaggcgaagggttacgtcgagacggtgttcgggcgccggctgtatctgcccgac
atccgcgcgcagcaggtggggcgccgccagggggccgagcgcgcggcgatcaatgcgccg
atgcagggtacggcggcggatctcatcaagaaggcgatgatcgcggtgcacggctggctc
ggggcgtcggggctcaggtcgcgcctgatcctgcaggtgcatgacgaactggtgctggaa
gtgccgcgcgacgagctcgagctgatgcgccgcgaactgcccgcgcgaatgggcggcgtg
gccgagctcgcggtgccactgctggtcgaggtcggggcggggaacaactgggatgaagcg
cactga

DBGET integrated database retrieval system